KEGG   Syntrophothermus lipocalidus: Slip_0158Help
Entry
Slip_0158         CDS       T01253                                 

Definition
(GenBank) Glycosyl transferase, family 4, conserved region
  KO
K02851  UDP-GlcNAc:undecaprenyl-phosphate/decaprenyl-phosphate GlcNAc-1-phosphate transferase [EC:2.7.8.33 2.7.8.35]
Organism
slp  Syntrophothermus lipocalidus
Pathway
slp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:slp01003]
    Slip_0158
   01005 Lipopolysaccharide biosynthesis proteins [BR:slp01005]
    Slip_0158
Enzymes [BR:slp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.33  UDP-N-acetylglucosamine---undecaprenyl-phosphate N-acetylglucosaminephosphotransferase
     Slip_0158
    2.7.8.35  UDP-N-acetylglucosamine---decaprenyl-phosphate N-acetylglucosaminephosphotransferase
     Slip_0158
Glycosyltransferases [BR:slp01003]
 Polysaccharide
  Bacterial polysaccharide
   Slip_0158
Lipopolysaccharide biosynthesis proteins [BR:slp01005]
 O-antigen
  Slip_0158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_4 DUF2798
Motif
Other DBs
NCBI-ProteinID: ADI00958
UniProt: D7CJ69
LinkDB All DBs
Position
167755..168819
Genome map
AA seq 354 aa AA seqDB search
MSIHWQSYLVAFIIALVVARITVPLARKLAFKLGAVDEPDARKVHTNIMPRLGGLAIFAG
FVCAAAWAVQAQGPYLGIIIGGIIVFAVGALDDVFSLSPWAKLAGQILAAAVAVYCGVTV
HFMTNPFDGLIYLGKLGVPLTLLWIVGVTNAVNLVDGLDGLAAGVSGIAALSMGIIAFQQ
GEPAVALLCLALVGAVLGFLPYNFHPARIFMGDAGALFLGFVLACLAVVGLAKSAAVISL
FVPIVVLGIPVFDTFFAIIRRINKKVPIFAPDKNHLHHRLMALGFSHRQSVLIIYGISVI
FGGAAVALTYVTSPQATLILALLLVFVVIGATRIGIVTGREVKHKPQIYTDIHG
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgatacactggcagtcataccttgtcgcctttatcatagccctggtcgtggctcga
atcacggtccccctggcccgcaaactggcctttaagctgggggctgttgacgagcccgac
gcccgcaaggtgcatacgaacatcatgccccggctgggagggcttgccatattcgcagga
tttgtgtgcgctgcggcatgggcagtgcaagcccagggcccctacttaggtatcattata
ggaggaattatcgtctttgccgtcggggcactggacgacgtgttcagcctgtccccctgg
gccaagctcgcgggccagatcttggcagcggcggtagccgtttactgcggagtcaccgta
cacttcatgaccaacccgtttgacgggctgatctacctgggcaagctcggggttcccctg
accctcttgtggatagtcggggttaccaacgccgtcaacctggtggacgggctggacggg
ctggcggccggggtttccggtatcgcggccctcagcatgggtattattgcttttcagcag
ggagagccggcagtggccctgctctgcctggccctggtcggcgccgtcctcggctttcta
ccctataactttcacccggcccgcatcttcatgggtgatgccggtgcccttttcttaggc
ttcgtcttggcctgcctggcggtagtggggctggccaagagcgcggccgtgatttctttg
ttcgtcccgatcgtggttctcgggatcccggtattcgataccttttttgccattataagg
cgtattaataagaaggtgccgatcttcgcccccgacaagaaccacctgcatcacagactg
atggcactggggttcagccaccgccagagcgtcttgataatttacggcatcagcgttatc
ttcggcggggcagcggtggctttgacttacgtcaccagcccccaggcgacgctgatcctg
gccctgcttctggtcttcgtggtcatcggggccacccgcatcggcatcgtcaccggccgc
gaggttaaacataagccacagatttacacagatattcacggatga

DBGET integrated database retrieval system