KEGG   Syntrophothermus lipocalidus: Slip_0506Help
Entry
Slip_0506         CDS       T01253                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, A subunit
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
slp  Syntrophothermus lipocalidus
Pathway
slp00970  Aminoacyl-tRNA biosynthesis
slp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slp00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Slip_0506
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:slp03029]
    Slip_0506
Enzymes [BR:slp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Slip_0506
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Slip_0506
Mitochondrial biogenesis [BR:slp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Slip_0506
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ADI01290
UniProt: D7CKQ5
LinkDB All DBs
Position
516093..517547
Genome map
AA seq 484 aa AA seqDB search
MRLCELTAHELKDMLAQREITAQDIVESCLDRIGEVEENIKAFVTLTPEAARDSARKLHE
EGGYRGLAGIPCGLKDNLCTRGIRTTCSSRMLENFVPPYDATVVSKLRGEKAVFMGKLNM
DEFAMGSSTENSAFFPTRNPWDPERVPGGSSGGSAAAVAAGEVIYALGSDTGGSIRQPAS
FCGVVGMKPTYGRVSRYGLVAFASSLDQIGTLTKDVTDCALVMNVIAGHDRLDSTSIDAP
VPDYTKFLVPDIKGFRIGYPREYFQEGVDDAVKETINRAMLKMEEMGAVVEETSLPHTEF
ALPAYYIIAPAEASSNLARFDGVRYGLRDVKAESVIDMFASSRALGFGPEVKRRIMLGTY
ALSSGYYDAYYLKALKVRRLIKEDFDWAFDKYDVLVTPTAPTVAFKLHEKTDNVLAMYMS
DIATIPVNLAGLPAMSIPCGFVNGLPVGLQIIGRPLEEGTLLRVAYAFEQSTGMARLRPR
LGVN
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
gtgcggctatgtgaattgactgcccatgaattgaaagacatgctggcccaaagagagatt
acggcccaagacatagtggaatcatgcctggaccgcataggtgaagtggaagagaacatc
aaagcgtttgttacgttgactccggaggcggcgcgcgattccgcgcgcaaactgcatgaa
gaaggcggttacagagggttggccggcatcccatgtggattgaaggacaatttgtgcacc
cgcggcataaggactacctgttcttcccgcatgctcgaaaattttgttcccccttatgat
gctacggttgtttccaaacttcggggagaaaaggccgtattcatgggtaagctcaatatg
gacgagtttgccatgggttcttccacagagaactcggctttcttccctactcgcaatccc
tgggatccggaacgggttcccggtggttcttccggtggttcggcggctgcagttgctgcc
ggcgaggtgatatacgccctcggttctgacacgggtggttccatacggcagccggcgtcg
ttttgcggggttgtgggtatgaagcctacatacggaagggtttctcgctatggtttggtt
gcctttgcatcgtctctggatcagatagggactttgaccaaggacgtgaccgactgtgcc
ctggtgatgaatgttatcgccggccatgacaggctggactccacaagtatcgacgctcct
gtacctgattatacaaagtttttagtacctgatataaagggctttcggataggttatccc
cgcgagtattttcaagagggagtagacgatgcggttaaggaaaccatcaaccgggccatg
ctgaagatggaagagatgggggcagtggtagaagagacttcccttccgcataccgagttc
gctttacctgcatactacatcattgccccggctgaggccagctccaatttggccaggttt
gacggggtaagatatgggttgagagatgttaaggccgaaagcgttatcgacatgtttgcc
agttccagggccttaggctttgggccagaagtgaaaaggcgaataatgctggggacctat
gccctttcctctgggtattatgatgcgtattaccttaaggctttgaaggtaagacggctg
attaaggaggatttcgattgggcttttgataaatacgatgttttagtgactccaactgct
cccacagttgcctttaagcttcatgaaaaaacggataatgttctggccatgtatatgtct
gacatagctaccattcccgtgaatctagcaggattgccagctatgtccataccctgtgga
tttgtaaacgggttaccggttggcttacaaataatcggtaggccgctggaggagggaact
ttgttgagggtggcatacgcttttgaacagagtacagggatggctcgtttgagacctcgg
ctgggggtgaactga

DBGET integrated database retrieval system