KEGG   Syntrophothermus lipocalidus: Slip_0511Help
Entry
Slip_0511         CDS       T01253                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
slp  Syntrophothermus lipocalidus
Pathway
slp00020  Citrate cycle (TCA cycle)
slp00480  Glutathione metabolism
slp01100  Metabolic pathways
slp01110  Biosynthesis of secondary metabolites
slp01120  Microbial metabolism in diverse environments
slp01130  Biosynthesis of antibiotics
slp01200  Carbon metabolism
slp01210  2-Oxocarboxylic acid metabolism
slp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:slp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Slip_0511
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Slip_0511
Enzymes [BR:slp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Slip_0511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ADI01295
UniProt: D7CKR0
LinkDB All DBs
Position
522169..523437
Genome map
AA seq 422 aa AA seqDB search
MVEGEKIRVVNGALQVPDNPIIPFIIGDGTGPDIWAAASRVLEAAVERAYQGKKKIVWKE
ILAGEKAFNLIGQWLPQETIDTIREYVIAIKGPLTTPIGGGIRSLNVALRQELDLYACVR
PVRYFKGVPSPVKRPEDTDMVIFRENTEDIYAGIEWPKGSEEVKKVIRFLKDEMGVKNIR
FPETSAIGIKPISEEGSKRLVRAAIRYALSEGRKSVTLVHKGNIMKFTEGGFKNWGYEVA
EQEFGDHVFTWNQYDEIKERKGEKAANEAQAEAEAQGKLIVKDVIADIFLQQILTRPREF
DVIATMNLNGDYISDALAAQVGGIGIAPGANINYDTGHAVFEATHGTAPKYAGLDKVNPS
SVLLSGEMMLRHLGWHEAADLIIGAVERTIASKIVTYDFARLMEGATEVKCSEFGDALIQ
NL
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
ttggtcgagggtgaaaaaatcagggtggtcaacggagcgctgcaggttccggataatccg
ataattccttttattatcggtgatggtaccgggcccgatatatgggcagcagcatcaagg
gtactcgaggctgcggtagaaagagcatatcagggcaagaaaaaaattgtatggaaagag
attctcgcgggtgaaaaggcttttaacttgataggacagtggcttcctcaggaaaccata
gataccatcagggagtacgttatagcaataaaagggccacttactactcctataggtggc
ggcatccgttctctgaacgtggctttgcggcaagagctggatctatatgcctgtgttaga
ccggtgcgttatttcaaaggagtaccatctccggtcaaaaggcccgaggacacggacatg
gtgatatttagagaaaatacagaagacatctatgcaggcatcgagtggccaaaagggtcg
gaagaggtcaagaaggtcataaggttcttaaaagacgaaatgggagtgaaaaacataagg
tttcccgaaacatcggccattggcataaagcccatatcggaagaagggagcaagaggctg
gttcgagcggcaataaggtatgcgctgagcgaaggacgaaagagcgtgaccctggttcac
aaggggaacattatgaagtttactgagggaggcttcaagaactgggggtacgaagtagcg
gaacaggagtttggggaccacgtctttacctggaaccagtacgatgagatcaaggaacgt
aaaggagaaaaagcagctaatgaggctcaagcagaggctgaggcccagggcaagctcata
gttaaggacgtaattgccgatatctttttgcagcagatactgacccgtcctcgagaattc
gatgttatagctactatgaacctcaatggtgattacatttctgatgcgttagccgcgcag
gtaggggggattggaattgccccaggagctaacatcaactatgatactggacatgcggta
tttgaagcaacccacggaacagctcccaaatacgccgggctggacaaggtcaatccttcc
tcggttcttttgtcaggggaaatgatgttgcggcacttgggatggcatgaagccgcggat
ctcattataggagctgtggaaagaaccatagcgagtaagatcgtgacctatgactttgcc
cggttgatggagggcgcaaccgaagtaaaatgctcggaattcggggatgctctaattcaa
aacctgtag

DBGET integrated database retrieval system