KEGG   Syntrophothermus lipocalidus: Slip_1170Help
Entry
Slip_1170         CDS       T01253                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
slp  Syntrophothermus lipocalidus
Pathway
slp00473  D-Alanine metabolism
slp00550  Peptidoglycan biosynthesis
slp01100  Metabolic pathways
slp01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:slp00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Slip_1170
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Slip_1170
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Slip_1170
Enzymes [BR:slp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Slip_1170
Peptidoglycan biosynthesis and degradation proteins [BR:slp01011]
 Precursor biosynthesis
  Amino acid ligase
   Slip_1170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 CPSase_L_D2 ATP-grasp ATP-grasp_4 TTL GARS_A ATPgrasp_ST RimK Flavodoxin_2 ATPgrasp_YheCD B12-binding
Motif
Other DBs
NCBI-ProteinID: ADI01943
UniProt: D7CMK8
LinkDB All DBs
Position
complement(1211557..1212501)
Genome map
AA seq 314 aa AA seqDB search
MGKKVLVLYGGKSKEREVSLRSGRAVADALSQKGFEVSVLDLNENSVASIVADRPDVAFI
ALHGKYGEDGTVQGLLDILEIPYVGSDVLTSAVCINKATTKKILAYEQLPTAPFVILNTE
RGPKIGLAEMADKVVKELGLPAVVKPATQGSSIGTTIVKKEEALIPALETALGYDGELVV
ERFIDGTEVTASVLGNEDAEVLPLIEIVAENEFYDYEAKYTPGMSHHIIPARISERARVR
VEEIALKTYHAFKCRGFSRVDFIVDKNDNPFVLEINTIPGMTSLSLFPDAARAAGMSFED
LCARLVELALSAKK
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
gtgggtaagaaggtgctggttctttacggggggaaatctaaagaacgggaggtctcgctt
cgcagcggcagggccgtagccgatgccctgtcccaaaaggggttcgaggttagtgttctc
gacctaaatgaaaactcggtagccagcattgtcgcggacaggccagatgtagcattcatc
gctcttcacggtaagtacggagaggatggaacagtccaaggcttgctcgatatcttagaa
ataccctacgtcggttcagacgttctcaccagtgcggtgtgtataaacaaggctacgacg
aagaaaatattagcctatgaacaactgcctacggctccttttgtcatccttaacacggaa
cggggtcccaagataggcttggcagaaatggcggacaaagttgtaaaggaactgggcctg
cctgcagtagtcaagcctgcaactcaagggtctagcataggcactaccatcgtcaaaaag
gaagaggcccttattccggccctcgaaactgctctgggttatgacggggagctagtggta
gaaaggttcatcgacggtacagaagtaaccgcatcagtgttaggcaacgaagatgccgag
gtacttcccctaattgaaatagtggccgaaaacgagttctacgattacgaagccaagtac
acgcccggtatgagtcaccacataatcccggcccgtatcagtgagcgggcgcgggtcagg
gtggaagagattgcgttgaaaacataccatgccttcaaatgccggggtttttcgagggta
gatttcatcgtagacaagaatgacaatccgtttgttctcgagataaatacaattcccggc
atgacttcgctcagcttgttcccggatgcagctcgagcggcgggaatgagctttgaggac
ctatgtgcccgcttggtcgaattggccttatccgccaaaaaataa

DBGET integrated database retrieval system