KEGG   Syntrophothermus lipocalidus: Slip_1784Help
Entry
Slip_1784         CDS       T01253                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
slp  Syntrophothermus lipocalidus
Pathway
slp00473  D-Alanine metabolism
slp01100  Metabolic pathways
slp01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:slp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Slip_1784
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Slip_1784
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:slp01011]
    Slip_1784
Enzymes [BR:slp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Slip_1784
Peptidoglycan biosynthesis and degradation proteins [BR:slp01011]
 Precursor biosynthesis
  Racemase
   Slip_1784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ADI02539
UniProt: D7CPA4
LinkDB All DBs
Position
complement(1853004..1854143)
Genome map
AA seq 379 aa AA seqDB search
MMHLARPTWAEVDLGAVAHNLKELRNLLVGTARLMPVVKANAYGHGILEVARTCVEEGAE
FLAVALLDEALLLKEAGINRPRILVLGATSEEGAQEAVKQGVRLTCFDRRLAEAVSRVAC
KLQKPGYIHIKIDTGMGRLGFYPDERALADIEEFLRLPGLEVEGIFTHFAAADAADKSYT
EWQLRRFLDFVGELEQKGVKIPLKHAANSAALIDLPSAHLDLVRPGISVYGLWPSDEVAN
RCLNLIPAMRLLSRIVMLKDLPPGHAVSYGCTYITTRTTKVATVPIGYADGYSRLLSGKV
HAVVRGKRVCGIGRICMDQCMFDVSEVEGVREGDEVILFGRPEDGVTADELASLIGTINY
EIVCMLGPRIPRIYKRSKL
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgatgcatctggcaagaccaacctgggcagaggtagacttgggggctgtagcccacaac
ctaaaagaattgagaaacctgcttgtagggacagctcgcttgatgccggttgtgaaggct
aacgcgtacgggcacgggattctggaggttgccaggacatgtgtagaggaaggggccgag
ttcttagctgtggctcttttggacgaagcgctcctgctcaaagaagccgggattaataga
cctagaattctggtgctgggcgctacctccgaggaaggggcccaagaggcggttaaacag
ggggtgcggcttacctgttttgaccggcgtctggccgaagccgtttcccgagttgcctgc
aagctgcagaagcccgggtacattcacatcaagatcgacaccggcatgggacggctggga
ttttatccagatgaaagagcattggcggacatcgaggaatttcttcgcctgccgggacta
gaggtagaagggatttttacccattttgccgcagccgacgccgctgacaagagctatacc
gaatggcagctccggcgttttctggactttgtgggtgaactcgaacaaaaaggggttaaa
attcctttaaaacacgcggccaacagcgcggctttaatcgatttaccatcagcgcatctc
gacttagtgagaccgggcataagcgtttacgggctgtggccttcggatgaagtggcgaac
cgatgcttaaacctcatcccggctatgcggcttctcagccggattgtgatgctgaaagac
ctgcctccaggccatgccgttagctacgggtgtacttacattacaacccgtaccacgaag
gtggctacggttcctatcggttatgctgatgggtatagtcggttactttccggcaaggta
cacgcggtggtaaggggaaagcgggtttgcggcatagggagaatatgcatggaccagtgc
atgtttgacgtttcggaggtcgagggggtcagagaaggggatgaagttatcttatttgga
cggccggaggacggtgttactgccgatgagctggcctccctcatcggaactatcaactac
gaaatcgtgtgtatgttagggccgcgcataccccgcatttacaagcggagtaagttgtaa

DBGET integrated database retrieval system