KEGG   Serratia liquefaciens: M495_00240Help
Entry
M495_00240        CDS       T02740                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
slq  Serratia liquefaciens
Brite
Enzymes [BR:slq01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     M495_00240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AGQ28916
LinkDB All DBs
Position
complement(51759..52388)
Genome map
AA seq 209 aa AA seqDB search
MMIMSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQTYVNNANTVLEAYPELAQYSVEEL
IQDLDKVPADKRTFMRNNAGGHANHSLFWKGLKTGTTLGGSLKAAIERDFGSVEKFQEEF
EKAAATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAVAGASGFPIVGLDVWEHAYYLK
YQNKRPDYIKAFWNVVNWDEAAARFAAKK
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgatgattatgagttattcactgccatccctgccgtacgcctacgacgcactggaaccg
catttcgacaagcagacgatggaaatccatcacaccaaacatcaccagacctacgttaac
aacgccaacaccgtactggaagcctacccagagctggcgcaatacagcgttgaagaactg
atccaggatctggataaagtacctgctgacaagcgcaccttcatgcgtaacaacgccggc
ggtcacgctaaccacagcctgttctggaaaggcctgaaaaccggtaccacgctgggtggc
tccctgaaagccgctatcgagcgtgatttcggcagcgtagagaaattccaggaagagttc
gagaaagccgcagcgacccgcttcggttctggttgggcctggctggtgctgaaaggcgac
aaactggccgtggtatctaccgctaaccaagacagcccactgatgggcgaagccgttgct
ggcgcttcaggtttcccaatcgtgggcctggacgtgtgggaacacgcttactacctgaaa
tatcaaaacaaacgtccagattacatcaaggcattctggaacgtggttaactgggatgaa
gcggcagcacgcttcgctgcgaagaagtaa

DBGET integrated database retrieval system