KEGG   Serratia liquefaciens: M495_03175Help
Entry
M495_03175        CDS       T02740                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
slq  Serratia liquefaciens
Pathway
slq00473  D-Alanine metabolism
slq00550  Peptidoglycan biosynthesis
slq01100  Metabolic pathways
slq01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:slq00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    M495_03175 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    M495_03175 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    M495_03175 (ddl)
Enzymes [BR:slq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     M495_03175 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:slq01011]
 Precursor biosynthesis
  Amino acid ligase
   M495_03175 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATPgrasp_Ter ATP-grasp_3 ATP-grasp ATPgrasp_ST RimK TTL ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: AGQ29475
LinkDB All DBs
Position
691388..692308
Genome map
AA seq 306 aa AA seqDB search
MADKVAVLLGGTSAEREVSLQSGAAVLAGLREAGIDAHGIDIRDFPVTQLKEHGFTKVFI
ALHGRGGEDGTLQGMLEFLELPYTGSGVMASALTMDKWRTKMVWQSMGLPVAPYVALNRQ
QYAGAEKEALIARVEALGLPLIVKPSREGSSVGMSKVTERGQLEAALEEGFRHDDDVLVE
KWLSGPEYTVAMLGDRVLPSIRIQPAGVFYDYQAKYISDDTQYFCPSGLGAEQEAEMASL
ALRAYRGLDCSGWGRVDVMQDSDGSFYLLEVNTSPGMTSHSLVPMAARQSGLSFSQLVAR
ILELAD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggccgataaagttgccgtactgctgggtggcacctccgctgaacgtgaagtgtcattg
caatccggtgccgccgtgctggccgggctgcgtgaagccggtatcgacgctcacggcatc
gatatccgtgatttcccggtcacccagttgaaagaacatgggtttaccaaagtatttatc
gcgctgcatggccgaggcggtgaagacggcaccctgcaaggcatgctggagttcctcgaa
ctgccttataccggcagtggcgtgatggcttcggcactgaccatggacaagtggcgcacc
aaaatggtgtggcagtcgatgggcctgccggtggcgccttatgttgcgctgaaccgtcag
caatatgccggtgcagaaaaagaggcgctgatcgcgcgcgtagaggccttgggcctgccg
ctgatcgtcaagccaagccgtgaaggctccagcgttggtatgagcaaagttactgagcgt
ggccaactggaggcggctctggaagaaggtttccgtcatgacgacgacgtgctggtcgag
aagtggctgagcggtccggaatacacggtagcgatgctgggtgatcgggtattgccttcc
atccgcattcaaccggccggggtgttttacgattaccaggccaagtacatctcggacgat
acccagtatttctgtccgagcggcctgggtgcggaacaggaagccgaaatggcgtctctg
gcgttacgcgcctatcgtgggctggactgcagcggctggggccgtgttgatgtgatgcag
gatagcgatggcagcttctatctgcttgaggtgaatacctcgccgggcatgaccagtcat
agcctggtgccgatggcagcgcgccagtctggtttaagcttctcgcagctggtagcgaga
attttggaattggccgactga

DBGET integrated database retrieval system