KEGG   Serratia liquefaciens: M495_04455Help
Entry
M495_04455        CDS       T02740                                 

Definition
(GenBank) ATP-dependent dsDNA exonuclease
  KO
K03546  DNA repair protein SbcC/Rad50
Organism
slq  Serratia liquefaciens
Brite
KEGG Orthology (KO) [BR:slq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:slq03400]
    M495_04455
DNA repair and recombination proteins [BR:slq03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     M495_04455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_23 SbcCD_C SMC_N AAA_29 AAA_21 ABC_tran cobW NTPase_1 AAA_22 MMR_HSR1 AAA_25 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AGQ29717
LinkDB All DBs
Position
complement(959249..962500)
Genome map
AA seq 1083 aa AA seqDB search
MKILSLRLKNLNSLQGEWKIDFTVEPFASNGLFAITGPTGAGKTTLLDAICLALYHQTPR
LNVTPSQNELMTRHTAESLAEVEFEVKGVGYRAFWSQRRAKNSPDGNLQAPKVELALRDD
GKILADKVRDKLDLTAAITGLDFGRFTKSMMLSQGQFAAFLNADANDRAELLEELTGTEI
YGQLSERVFEQHKQAKTDLDALHQRASGIELLNEEQRQQLESQLVELSSQENTLSEQTQR
QQRALNWLQQWQQTQQKQQEYQRQLSAVQQEQAEAEPQLQQLARSEPAEKLRPLLNERNR
CRSDQQALQQQIAQLTQQQEQQLAQMTPLQQAVEQARAQLQAHVEHQQIQQRLIDEQIVP
LDHQITQLQKTQTELQQACDAATQQYAQQQAELEQLEVLRARLTAQTGQQQEQLNGLTAA
LAAQQQQQNALEAQAPLTALRQRQTELAELRPVRQKLFTLSSLFGQVSERLEQQRKEFTA
RQTQLSELEKQLEETRQQYKQQKAHQTDVEKALELEQRIVSLEAERARLQTGEPCPLCGS
SEHPAIEQYQAVKPSETALRLADMRVKTEALYTQGTELRTRCESLKEQLQRQQHLIGQDE
QQLAAHRQQWQTLSTPLAFDFDLQDTARLSQWLSDCDNEERQAQASLLQHEQAAQAVQQA
KDRLAALQTQQQQAQQEKALLDERFSLLEKSHAEAQSQQQRLQQQRQEAEQALGEQRTQR
LALFGEQQIVQVREQLRARQTACEQAIQLAAEHWQKAQEQRDRLGGQLTGLQQQLLHLAE
RLQQAEQDWLQALSTSEFDDEAAFNAALLNDDQRQQLQRRKEQLQQRQVEASALLTQAVA
NLEQQRQQRPEGLDESQADPQTLGQDLAALAQQLKTLQLRQGEVRNQLESDAARRLNQQS
LFEQISQSQQQYDDWSYLNQLIGSKEGDKFRKFAQGLTLDHLVYLANNQLGRLHGRYLLQ
RKTSDALELQVVDTWQADALRDTRTLSGGESFLVSLALALALSDLVSHKTSIDSLFLDEG
FGTLDAETLDTALDALDSLNASGKTIGVISHVEAMKDRIPVQIKVKKVNGLGISRLEPQF
RLE
NT seq 3252 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcctcagcctgagattaaaaaacctcaattcgctgcagggggaatggaagata
gacttcaccgtcgagcccttcgccagcaacggattatttgccatcaccggccccaccggc
gcgggtaaaaccaccctgctggacgccatctgtctggcactgtaccaccagacgccgcgc
ctgaatgtcacgccaagccaaaatgagctgatgacccgccacaccgccgagtcgctggcg
gaggtcgagtttgaggttaaaggcgtcggttaccgcgcgttctggagccagcgccgtgcc
aaaaactccccggacggcaacctgcaggcgccgaaggtggagctggcgctgcgcgatgac
ggcaagatcctggccgataaagtccgcgacaagctggatcttaccgccgcgatcaccgga
ctggatttcggtcgttttaccaaatcgatgatgttgtctcaggggcagttcgctgccttc
ctgaatgccgatgccaatgatcgggccgaactgctggaagagttgaccggcaccgagatt
tacggccagctttccgagcgcgttttcgagcagcacaaacaggccaaaaccgatctggac
gcgttgcatcagcgcgccagcggcattgagttgctgaacgaagaacagcgccaacagctg
gaaagccagctcgtggagctcagttcgcaggaaaataccctcagcgaacagacccagcgt
cagcaacgggcgttaaactggctacagcaatggcagcagacgcagcagaaacagcaggaa
taccagcgtcagttgagcgccgtacaacaggagcaggctgaggcagaaccccagctgcag
cagttggcgcgcagcgagccggcagagaaactgcgcccactgctcaacgaacgcaaccgc
tgccgcagcgatcaacaggcgctacaacagcagattgcccagttgacgcagcaacaggag
caacagcttgcccagatgaccccgttgcagcaggcagtggaacaagcacgtgctcaactg
caggcgcatgtcgaacaccagcagatccaacaacgtctgatcgacgagcagatcgtcccg
ctcgaccaccagataacccagttgcaaaaaacgcagacagaactgcaacaggcctgcgat
gccgccacgcaacagtatgctcagcaacaagcggagctggaacaactcgaggttttacga
gcccggctcaccgcccagaccggacagcagcaggagcagcttaacggcctcactgccgca
ctggcagcgcagcaacagcagcaaaatgcgctggaagcccaagcccccctaacagcgctg
cgccaacgtcagaccgaactggccgagctgcgtccggtgcgccagaaattatttaccctc
tcctcgctgtttggccaggtcagcgaacgtctggaacaacaacgcaaggagttcacggcc
cgtcagacccagctcagcgagcttgaaaagcagcttgaagaaacacgccagcagtacaaa
cagcaaaaagcacatcagacggacgtagagaaagcccttgagctggagcaacgcatcgtc
agcctggaggcggaacgcgctcgcctgcaaaccggcgaaccttgtccactgtgcggatct
tccgagcatccggccatcgaacagtatcaggcggtaaaaccctctgagacagcactgcgt
ctggccgatatgcgcgtcaaaaccgaggctttgtacacccagggcaccgagctgcgcacc
cgctgcgaaagcctgaaagagcaactgcagcgccagcaacatcttatcggccaagatgaa
caacagctggccgctcatcgtcagcaatggcaaaccctcagcacgcctctggcgtttgat
tttgatctgcaggacaccgctcgccttagccagtggttaagcgactgcgacaatgaggag
cgtcaggctcaggccagtctgctgcaacacgagcaggcagcccaggcggtacagcaggct
aaagaccggttggccgcactgcagacacagcagcaacaggcgcagcaagaaaaggcactg
ctggacgagcgtttcagcctgctggaaaaaagccacgccgaggcccaatcgcagcagcaa
cgcctgcagcaacagcgtcaagaagcagagcaagctctgggcgaacaacgtacgcagcgg
ctggcgctgtttggcgaacagcaaatcgtgcaggtgcgtgaacagctgcgtgcccggcag
acggcctgcgaacaggctatacaactggccgcagagcactggcagaaggcgcaggaacaa
cgcgatcgtcttggcgggcaactcaccgggttgcagcaacagctgttgcacctggccgaa
cggctgcaacaggcggagcaagattggctgcaagcgttgtccaccagcgaattcgacgac
gaagcggccttcaacgctgccctgttgaatgacgatcagcgccaacaattgcaacggcgc
aaagagcagctgcagcaacggcaggttgaagccagcgccctgctgacccaggccgtagcc
aatctggaacagcaacgccaacagcgtccggaagggctggatgaaagccaggccgatccc
caaaccctgggccaggatctggccgcgctggcgcagcagctcaaaactctgcagctccga
cagggtgaagtgcgcaaccagttggaaagtgatgccgcgcgccgtctcaatcagcagtcg
ctgtttgagcaaatcagccaaagtcagcaacaatacgacgactggagctacctcaatcag
ctcatcggctccaaagagggggataaattccgtaagtttgcccaaggactgacgctcgat
catctggtgtacctggccaataaccagttgggccggttgcacggccgctatctgctgcag
cgcaaaaccagtgatgcactggaattgcaggtggtggacacctggcaggcggacgcactg
cgcgacactcgaaccctgtccggcggtgaaagcttcctggtgagccttgcgctggcgctg
gcgctgtccgatctggtcagccacaagaccagtatcgattcgttgttccttgacgagggc
ttcggtacgctggatgcggaaactctggacaccgcgctggacgcactggacagcctgaac
gcctccggcaaaaccatcggcgtgatcagccacgttgaagccatgaaagatcgtattcca
gtgcagattaaggtgaaaaaggtgaacggcctgggtatcagccggctggagccgcagttc
cggctggaataa

DBGET integrated database retrieval system