KEGG   Serratia liquefaciens: M495_05700Help
Entry
M495_05700        CDS       T02740                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
slq  Serratia liquefaciens
Pathway
slq00020  Citrate cycle (TCA cycle)
slq00190  Oxidative phosphorylation
slq00650  Butanoate metabolism
slq01100  Metabolic pathways
slq01110  Biosynthesis of secondary metabolites
slq01120  Microbial metabolism in diverse environments
slq01130  Biosynthesis of antibiotics
slq01200  Carbon metabolism
Module
slq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
slq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
slq_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:slq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    M495_05700 (sdhB)
   00650 Butanoate metabolism
    M495_05700 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    M495_05700 (sdhB)
Enzymes [BR:slq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     M495_05700 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     M495_05700 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_18 Fer4
Motif
Other DBs
NCBI-ProteinID: AGQ29952
LinkDB All DBs
Position
1221774..1222490
Genome map
AA seq 238 aa AA seqDB search
MKLEFSIYRYNPDVDDAPHMQDYSLEAEEGRDMMLLDALILLKEKDPSLSFRRSCREGVC
GSDGINMNGKNGLACITPISSLRKGNNKIVIRPLPGLPVVRDLVVDMGQFYTQYEKIKPY
LQNDGKNPPAREHLQSPEQRAKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYR
FLIDSRDTETEERLDDLDDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRGA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgaattttcaatttatcgctacaatccggatgttgatgacgctccgcacatg
caggattacagcctggaagcggaagaaggtcgcgacatgatgttgctggatgccttgatc
ctgctgaaagaaaaagatcctagcctgtcgttccgtcgttcctgccgcgaaggcgtttgt
ggttccgacgggatcaacatgaacggtaaaaacggcctggcatgcatcaccccgatctcg
tcgctgcgtaaaggcaacaacaagattgtgatccgcccgctgcctggcttgccggtagtg
cgcgatctggtggtggatatgggtcagttctacacccagtatgaaaagatcaaaccttac
ctgcagaacgacggcaagaacccgccggcgcgtgaacacctgcaatcgccagagcagcgc
gccaagctggacggactttatgagtgcattttatgcgcttgttgttcgacctcttgcccg
tcattctggtggaacccggacaaattcattggcccggctggcctgctggcggcataccgc
ttcctgattgacagccgcgacacggaaaccgaagaacgtttagacgatctagacgacgct
ttcagtgttttccgctgccatagcattatgaattgtgtcagtgtatgtcctaaaggcttg
aacccgacgcgtgctatcggtcatatcaagtctatgctgctgcaacgcggcgcataa

DBGET integrated database retrieval system