KEGG   Serratia liquefaciens: M495_05825Help
Entry
M495_05825        CDS       T02740                                 

Definition
(GenBank) phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
slq  Serratia liquefaciens
Pathway
slq00400  Phenylalanine, tyrosine and tryptophan biosynthesis
slq01100  Metabolic pathways
slq01110  Biosynthesis of secondary metabolites
slq01130  Biosynthesis of antibiotics
slq01230  Biosynthesis of amino acids
slq02024  Quorum sensing
Module
slq_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:slq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    M495_05825
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    M495_05825
Enzymes [BR:slq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     M495_05825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: AGQ29972
LinkDB All DBs
Position
1246674..1247726
Genome map
AA seq 350 aa AA seqDB search
MNYQNDDLRIKEIKELLPPVALLEKFPATERAAETVSKARSAIHQILRGSDDRLLVVIGP
CSIHDTKAAKEYAGRLLSLRQELSGELEVVMRVYFEKPRTTVGWKGLINDPQMDNSFQIN
DGLRLARKLLLDINDTGLPAAGEFLDMITPQYLADLMSWGAIGARTTESQVHRELSSGLS
CPVGFKNGTDGTIKVAIDAINAASAPHCFLSVTKWGHSAIVNTSGNGDCHIILRGGKEPN
YSAAHVKEVKEGLVKAGLPAQVMIDFSHANSSKQFKKQLEVNADVCKQIAGGEKAIMGVM
IESHLVEGNQNLESGDPLVYGKSVTDACIGWEDTETVLRELATAVKARRG
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaattaccaaaacgacgatttacgcattaaagaaattaaggaactcctgccaccggtg
gctctgttagagaagtttccggctactgaacgtgcagcagagacggtgtcaaaggcacgc
agtgccattcatcagatccttcgcggcagtgacgatcgcctgctggtggtgattggccct
tgttcaatccacgataccaaagcggcgaaagagtatgccggtcgcctgctgtcgctgcgt
caggaactgagcggcgagctggaagtggtgatgcgggtttattttgaaaagccgcgtacc
accgtgggctggaaagggttgatcaacgatccgcaaatggataacagcttccagatcaac
gacggtctgcgtctggcccgtaagctgctgctggatatcaacgataccggtttgccggcg
gcgggcgaattcctcgacatgatcaccccgcagtatctggcagatctgatgagctggggc
gcgatcggcgctcgtaccactgaatctcaggtgcatcgcgagctctcttccggcctgtct
tgcccggttggcttcaagaacggtaccgacggcaccatcaaggttgctattgacgccatc
aatgctgccagcgcaccgcactgtttcctgtcggtgaccaaatggggccattcagccatt
gtgaacaccagcggtaacggcgattgccacattattctgcgcggcggcaaagagccgaac
tacagtgcagcgcatgtgaaagaagtcaaagaaggcctggtcaaagcaggtctgccagcg
caggtgatgatcgatttcagccatgccaacagcagcaagcaattcaaaaagcagctggaa
gtgaatgctgacgtttgcaagcagattgccggcggcgaaaaggcgattatgggcgtgatg
attgaaagccatctggtggaaggcaaccaaaacctggaaagcggcgatccgctggtttat
ggcaagagcgtcaccgacgcctgcatcggttgggaagacaccgaaaccgtgctgcgcgag
ttggcaacagcggtgaaagcgcgccgcggttga

DBGET integrated database retrieval system