KEGG   Serratia liquefaciens: M495_09605Help
Entry
M495_09605        CDS       T02740                                 

Definition
(GenBank) xyla
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
slq  Serratia liquefaciens
Pathway
slq00040  Pentose and glucuronate interconversions
slq00051  Fructose and mannose metabolism
slq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    M495_09605
   00051 Fructose and mannose metabolism
    M495_09605
Enzymes [BR:slq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     M495_09605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AGQ30684
LinkDB All DBs
Position
2019954..2020934
Genome map
AA seq 326 aa AA seqDB search
MSELKFATRLNSFASGAHLYWPEQKGKPTVPQMIERAATVKGLTHLDLNYPQHMTGDIKV
MRQKIEDVGLAVNGMQMRWDAPEFKIGAFTHPDPKIRRQAIELTKRGIDAGREFGAGIMT
LWMGQDGFDYCFQADYKKIWEDAVSAVREVAEYAPDIDISIEYKPNEPRAYSIFPNATTC
LLAVEEAGCKNLGITLDFAHVLFANEVPAFAAAMVARRSRLLGLDLNDGWGKRDDGLMVG
SVNPRATLEFLLQMKRDGYKGAYYFDTFPDASGLDPVREAETNIATVLRLLTLCEKLENN
PALAEAISRQDAVASQQIVNNVMLAQ
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaacttaaatttgccacacgcctgaactcgtttgcctcgggggctcatctttac
tggccggaacaaaaaggaaaacctaccgttccgcaaatgatcgaacgtgcagctacggtt
aaaggattgacacatctggatctgaattatccacaacatatgaccggcgacatcaaagtg
atgcgtcagaaaatagaggacgtcgggctagcggtaaacggcatgcagatgcgctgggat
gctccggaattcaaaatcggtgcatttactcacccggatccgaaaattcgccgtcaggcg
atcgaattaaccaagcgcggcatcgacgccgggcgtgaattcggtgccggcattatgacg
ctttggatggggcaggatggtttcgattactgcttccaggccgactataaaaaaatatgg
gaagacgcggtcagcgcggttcgtgaagtggcggaatatgcaccggatatcgacatcagc
attgagtacaaaccgaacgaaccacgtgcttatagtatttttccgaatgccaccacgtgc
ctgctagcggtggaagaagcgggatgcaaaaaccttggcatcacgttggatttcgcacat
gtgttgtttgcgaatgaagtcccggcgtttgcagctgctatggtggctcgccggtcccga
ttactggggctggatctcaatgacggctggggaaaacgcgacgacggtctgatggtcgga
tccgtgaacccgcgtgccacactggaattcctcttgcagatgaaacgcgatggctacaaa
ggggcgtattacttcgataccttccctgacgccagcgggttggacccggtgcgtgaagcg
gaaaccaacattgcgacagttctgcgtttactcacactgtgtgaaaaactcgaaaacaac
ccggcgctggctgaagccattagcaggcaggacgcagttgcctcgcagcaaatcgtcaat
aacgtgatgctggcacaataa

DBGET integrated database retrieval system