KEGG   Serratia liquefaciens: M495_09920Help
Entry
M495_09920        CDS       T02740                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
slq  Serratia liquefaciens
Pathway
slq00020  Citrate cycle (TCA cycle)
slq00480  Glutathione metabolism
slq01100  Metabolic pathways
slq01110  Biosynthesis of secondary metabolites
slq01120  Microbial metabolism in diverse environments
slq01130  Biosynthesis of antibiotics
slq01200  Carbon metabolism
slq01210  2-Oxocarboxylic acid metabolism
slq01230  Biosynthesis of amino acids
Module
slq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
slq_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:slq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    M495_09920
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    M495_09920
Enzymes [BR:slq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     M495_09920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: AGQ30747
LinkDB All DBs
Position
2091128..2092381
Genome map
AA seq 417 aa AA seqDB search
MESKVVVPAEGKKITVDAQGKLVVPNNPIIPFIEGDGIGVDVTPAMIHVVDAAVKKAYHG
ERKISWMEIYTGEKSTHVYGKDVWLPEETLDLIRDYRVAIKGPLTTPVGGGIRSLNVALR
QQLDLYVCLRPVRYYQGTPSPVKQPELTDMVIFRENAEDIYAGIEWKAGSAEADKVIKFL
RDEMGVKKIRFPEQCGIGVKPCSEEGTKRLVRAAIEYAITNDRDSVTLVHKGNIMKFTEG
AFKDWGYELAREEFGGELIDGGPWLKIKNPNTGKEIVVKDVIADAFLQQILLRPAEYDVI
ACMNLNGDYISDALAAQVGGIGIAPGANIGSDCALFEATHGTAPKYAGQDKVNPGSIILS
AEMMLRHMGWFEAADLIVKGMEGAIAAKTVTYDFERLMEGAKLLKCSEFGDAIVKHM
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagttgttccggcagaaggtaaaaagattacggtcgatgcccagggt
aaactggttgttccgaataacccgatcattccgtttatcgaaggcgacggcattggcgtt
gacgttacccctgctatgattcacgtggttgatgcagcagtgaaaaaggcctaccacggc
gaacgtaaaatctcctggatggaaatctacaccggcgaaaaatccactcacgtttacggg
aaagacgtgtggctgccggaagaaaccctggatctgatccgtgactaccgcgttgccatc
aaaggcccgctgactaccccagtcggtggcggtattcgctccctgaacgtggccctgcgc
cagcaactggacctgtacgtgtgtctgcgtccggtgcgttactaccagggcactccaagc
ccggttaaacagccagagctgaccgacatggtgatcttccgcgaaaacgccgaagacatc
tacgcaggtatcgagtggaaagccggttctgcagaagcagacaaagtgatcaagttcctg
cgcgacgaaatgggcgtgaaaaaaatccgcttcccagagcaatgtggtatcggcgtgaag
ccatgttctgaagaagggactaaacgtctggtacgtgcggcgatcgaatacgcgatcacc
aacgaccgcgactctgtgaccctggttcacaaaggcaacatcatgaagttcaccgaaggt
gccttcaaggattggggctacgaactggcgcgcgaagagttcggtggcgaactgatcgac
ggcggcccatggctgaaaatcaagaacccgaacaccggtaaagagatcgtggtaaaagac
gtgatcgccgatgccttcctgcagcaaatcctgctgcgtccggctgaatacgacgtgatc
gcctgtatgaaccttaacggtgactacatctccgacgccctggccgcgcaggttggcggt
atcggtatcgcacctggcgccaacatcggttccgattgcgcgctgttcgaagccacccac
ggtactgcacctaagtatgccggccaggataaagtgaacccaggttccatcatcctgtct
gcagaaatgatgctgcgtcacatgggctggttcgaagcggctgacctgattgttaagggc
atggaaggcgcaatcgctgccaagaccgtgacctatgacttcgaacgcctgatggaaggc
gctaagctgctgaaatgttcagagtttggcgacgctatcgttaagcacatgtaa

DBGET integrated database retrieval system