KEGG   Serratia liquefaciens: M495_11045Help
Entry
M495_11045        CDS       T02740                                 

Definition
(GenBank) glutathionine S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
slq  Serratia liquefaciens
Pathway
slq00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:slq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    M495_11045
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:slq02000]
    M495_11045
Enzymes [BR:slq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     M495_11045
Transporters [BR:slq02000]
 Other Transporters
  Pores ion channels [TC:1]
   M495_11045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_N GST_N_3 GST_N_2 GST_C_2 GST_C_6 Glutaredoxin2_C GST_N_5
Motif
Other DBs
NCBI-ProteinID: AGQ30956
LinkDB All DBs
Position
complement(2305169..2305774)
Genome map
AA seq 201 aa AA seqDB search
MKLFYKAGACSLSPHIVLREAGLDFTAEKVDLALKKTESGADYLTINPKGQVPALLLDDG
SLLTEGVAIVQYLADRVPDRALIPAAGTLSRYHAIEWLNYIATELHKGFSPLFNPKTPEE
YKAFTREKLEKQFSYLDSVLAKQHFLLGNRFSVADAYLFTVLRWAIAMQFDLKKHANLSA
YFDRVAARPAVDATLNAEGLK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttctataaagccggtgcctgttctctgtctccacacattgtacttcgtgag
gcgggcctggatttcacggcggaaaaggtcgatctggcgctgaagaaaacggaaagcggt
gccgactatctgaccatcaacccgaaaggacaagtgcctgcgctgctgttagatgacggc
agtctgctgaccgaaggcgtcgcgattgtgcaatacctggccgatcgcgtgccggatcgc
gctctgatccccgcagcgggcacgctatcgcgctaccatgcgattgagtggcttaactat
attgccaccgaactgcacaagggtttcagcccgctgtttaacccgaaaacgcctgaagaa
tacaaagccttcacgcgggaaaaactggagaagcagttcagctatctggattcggtgctg
gcgaagcagcatttcttgctggggaaccggtttagcgtggcagatgcctatttgtttacc
gttctgcgctgggctatcgccatgcagtttgatctcaaaaagcacgccaacctatcggcc
tattttgatcgcgtggccgcacggccggcagtagatgccaccttgaacgcggaaggattg
aaataa

DBGET integrated database retrieval system