KEGG   Serratia liquefaciens: M495_21685Help
Entry
M495_21685        CDS       T02740                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
slq  Serratia liquefaciens
Pathway
slq00250  Alanine, aspartate and glutamate metabolism
slq00410  beta-Alanine metabolism
slq00640  Propanoate metabolism
slq00650  Butanoate metabolism
slq01100  Metabolic pathways
slq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:slq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    M495_21685
   00650 Butanoate metabolism
    M495_21685
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    M495_21685
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    M495_21685
Enzymes [BR:slq01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     M495_21685
Amino acid related enzymes [BR:slq01007]
 Aminotransferase (transaminase)
  Class III
   M495_21685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AGQ32961
LinkDB All DBs
Position
complement(4567788..4569053)
Genome map
AA seq 421 aa AA seqDB search
MKNAELNQRRQDATPRGVGVMCGFYAERAENATLWDVEGNEVIDFASGIAVLNTGHRHPK
VIAAIEKQLKAFTHTAYQIVPYESYVSLAERINQCAPIEGPCKTAFFTTGAEAVENAVKI
ARAHTGRPGLITFGGGFHGRTYMTMALTGKVAPYKLGFGPFPGSVFHGQYPNALYGVTTE
DAMNSLERIFKADIDPKQVAAIVLEPVQGEGGFNVAPAEFMQALRTLCDEHGILLIADEV
QTGFARTGKLFAMDHYSVKPDLITMAKSLAGGMPLSAVAGRAEVMDAPAPGGLGGTYAGN
PLAVAAALAVLDVIEEEQLCQRSQRLGQHLVEVLQQARQSSPAIADIRAQGSMVAVEFND
PKTGKPSAEITRQVQQKALEEGLLLLSCGVNGNVIRFLYPLTIPEDQFTKALGILSRALA
Q
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgcagaattgaatcaacgtcgtcaggatgccaccccacgtggggtcggcgtg
atgtgcggcttttacgccgaacgcgccgagaacgccacgctgtgggatgtcgaagggaat
gaagttatcgattttgcctccggtatcgccgtgttgaataccggacaccgtcacccgaag
gtgatcgctgccattgagaagcagctgaaggccttcacccataccgcttaccagattgtc
ccttacgaaagctacgtttcgctggccgagcgcatcaaccagtgtgcgccgatcgaaggg
ccatgtaaaaccgcgttcttcaccacgggggcggaagcggtagagaacgccgtcaaaatt
gcccgcgcccacactggccgtccgggtctgatcaccttcggcggcggcttccacggccgc
acctacatgaccatggcgctgaccggcaaagtggcgccttacaaactgggctttgggcca
ttcccgggatcggtgttccacggccagtatccgaatgcgctgtatggcgtgaccaccgaa
gatgcgatgaacagcctggagcgtatctttaaagcggatatcgatcccaagcaggttgcg
gccatcgtgctggagcctgtgcaaggtgaaggtggtttcaacgtcgcaccggccgagttt
atgcaggcgttgcgcaccttgtgcgacgaacacggcattttgctgattgccgacgaagtg
caaaccggttttgcccgtaccggcaagctgtttgccatggatcattacagcgtcaaaccc
gatctgatcaccatggcgaaaagcctggcgggcggcatgccgttgtcggccgtagccggt
cgtgcagaggtgatggatgccccggcaccgggcgggctgggtggcacctatgccggtaac
ccgctggcggtggcggcagcgctggcggtgctggatgtgattgaagaagagcagctatgc
caacgttctcaacgcctgggccagcatctggtggaggtgctgcagcaggcacgccagagc
agcccggcgattgcggatattcgtgcgcagggttcgatggtggcggtagagttcaacgat
cccaagaccggcaaaccctcggccgagatcacccgccaggtgcaacagaaagcgctggaa
gaaggcctgctgctgctgagctgcggtgttaacggcaacgtgatccgcttcctgtaccca
ctgaccattcctgaagaccagttcaccaaggcgctgggcattctttcccgcgcgctggct
caataa

DBGET integrated database retrieval system