KEGG   Serratia liquefaciens: M495_22330Help
Entry
M495_22330        CDS       T02740                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
slq  Serratia liquefaciens
Pathway
slq00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:slq00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    M495_22330
Enzymes [BR:slq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     M495_22330
Transporters [BR:slq02000]
 Other Transporters
  Pores ion channels [TC:1]
   M495_22330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AGQ33088
LinkDB All DBs
Position
complement(4704904..4705572)
Genome map
AA seq 222 aa AA seqDB search
MIIVHHLNNSRSQRILWFLEELGVPYQVQRYQRDPQTMLAPAELKKIHPLGKSPVIVDGD
LTLAESGAIIEYLQEAYDAQGQFIPTDYHARQQYRYWLHYAEGSLMPLLVMKLVFSRLGQ
PPIPWLLRPVAGAIGKGVQREYLDKQIAPHRDYLEQHLAKSTWFVGNEFSAADIQMSFPL
EAMAARGALDGCPKLRDYLQRIHARPAYQRALEQGGPYDLLK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgattatcgtgcaccatctaaataactcgcggtcgcagcgcatcctgtggtttttggaa
gaattgggagtgccgtaccaggtgcagcgctatcagcgcgatccgcaaaccatgctggcg
cctgcggagttgaaaaagatccatccgctcggcaagtcgccagtgattgtcgatggcgat
ctgacgctggcggagtccggcgccattattgaatatctgcaggaagcctacgatgcgcag
gggcagtttatccccaccgactatcatgcccggcaacagtatcgttactggctacattat
gccgaagggtcactgatgccgctgttggtgatgaagctggtgtttagccgcttgggccag
ccgcccattccctggctgttacggccagtggcaggggctattggcaaaggcgtacagcgg
gagtatctggataaacagattgctccgcaccgcgactatcttgaacagcacctggccaaa
agcacctggtttgtcggcaatgaattcagcgcagcggacatccagatgagttttccgctg
gaagcgatggcggcacgtggcgcattggatggctgtccaaagctacgcgactatctccag
cgtatccatgcgcggccggcctaccaacgggcgctggagcagggcgggccttatgacctg
ctgaaatga

DBGET integrated database retrieval system