KEGG   Salinispira pacifica: L21SP2_3375Help
Entry
L21SP2_3375       CDS       T03013                                 

Definition
(GenBank) Alkyl hydroperoxide reductase protein F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
slr  Salinispira pacifica
Brite
KEGG Orthology (KO) [BR:slr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    L21SP2_3375
Enzymes [BR:slr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     L21SP2_3375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_oxidored HI0933_like Thioredoxin_3 FAD_binding_2 Thi4 DAO NAD_binding_8 AlaDh_PNT_C FAD_binding_3 Lycopene_cycl Glutaredoxin K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AHC16713
UniProt: V5WM46
LinkDB All DBs
Position
3634308..3635876
Genome map
AA seq 522 aa AA seqDB search
MLNSKIQEQLKDVFSELEGRVALEYASSEHSKEDELVTMLEDVASLSDQIEAVQGDFSHD
APWFRIVHNDTDTGIRFTGVPGGHEFTSLILAILHSDGKGKLPDSPSIRRIGAIQGPVSI
RTFVSLSCTNCPDVVQALNLAAVYNPDIEHHTIVGDFAQDEIERLGVQGVPAVFHGDTLI
HSGRSSLAELLPVLENTFGRKESGPMEAVEIPAVEVAVIGGGPAGCAAAIYSGRKGLKTA
IIASRIGGQVNDTADISNFISVSETTGSKLSADLRKHSGEYDIQIFEGRNVHSVETAGTN
GSEFHRIFSDSGEVFSAEQLIITSGASWRKLGVPGEDEYIGRGVAFCPHCDGPFFAGKDV
AVIGGGNSGVEAAIDLAGTCKSITLIEFLDELKADSVLTAKLKSLDNVEIITSARTTEIL
GDGKAVTGIKLEDRSSGEVRSLNLHGAFVQIGLLPNSSEYHDHVKVNRYGEIEVDTHGRT
SVPGMYAAGDVTTSPYKQIVIAMGDGAKAALTAFDDRIRGRV
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgcttaactcaaaaatacaggaacagttgaaagatgttttctccgagcttgaaggccgg
gttgctctggagtacgcctcctcggaacattccaaagaggatgaactggtaaccatgctg
gaagatgttgcctctctctcggatcagattgaagccgtccagggtgatttcagccacgac
gcaccatggttccgcattgtacataatgatacggatacgggaattcggtttaccggagtc
cccggaggtcatgagttcacctccctcattctggccatccttcacagcgacgggaaaggt
aaactgccggattccccatccattcggagaatcggggcaatacagggtcctgtgagcatc
agaacctttgtttccctgtcttgcaccaactgtccggatgtggtgcaggcattgaacctt
gcggcggtgtataaccctgatatcgagcatcacaccatcgtcggggactttgctcaggat
gaaatagaacggctgggagttcagggagtaccggcggtattccatggtgacaccctgatc
cattccggccgatccagtctggctgaactgcttccggtgctggaaaacacattcggccgg
aaggaaagcggtccgatggaagctgttgaaataccggcggtggaagttgccgtcatcggc
ggcggacctgcaggatgcgccgcagccatctattccggccgaaaaggactgaaaaccgcc
atcattgcctcccgcatcggcggacaggtgaacgacaccgcagatatttccaatttcatt
tcggtatcggaaaccaccggcagcaaactcagtgccgatctacggaagcacagcggggag
tatgacattcagattttcgaaggacggaatgtacattccgtggaaaccgccggaaccaac
ggctctgagttccaccgcatcttcagcgacagcggggaagtgttcagcgccgaacagctc
attattacaagcggagcatcctggagaaaactgggggttcccggtgaagatgaatacatc
ggtcgtggcgttgccttctgcccccactgcgacggtccgttttttgcaggaaaggatgtg
gcggttatcggcggaggaaactcaggggttgaggcggctattgatctggcgggaacctgc
aagagcatcaccctcatagaattcctggatgaattaaaggcggattcggtgcttactgca
aaactgaagagtctggataatgttgaaattatcacctccgcacggaccactgaaattctg
ggggacggaaaagcggtgaccggaatcaaacttgaagaccgaagcagcggggaagtccgg
tccttgaatcttcatggggctttcgtccaaatcggacttcttcccaacagcagtgaatac
catgatcacgtgaaggtgaaccggtacggcgaaattgaagtggacacccacggacgcacc
agcgtccccggcatgtatgcagccggagatgtcaccaccagcccctataaacaaattgtc
attgcaatgggggacggagccaaagcggctcttaccgcattcgatgaccggatcagaggc
agggtgtag

DBGET integrated database retrieval system