KEGG   Streptomyces lincolnensis: SLINC_2658Help
Entry
SLINC_2658        CDS       T04801                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
sls  Streptomyces lincolnensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: ANS64882
UniProt: A0A1B1M901
LinkDB All DBs
Position
complement(3149325..3150782)
Genome map
AA seq 485 aa AA seqDB search
MTELVEHGQLFIGGELTDPLGKDVIEVVSPHTEEVIGRVPHASTGDVDRAVAAARTAFDE
GPWPRMSLEERIEVVGRIKDAIAVRHEEIARMISSENGSPYSWSVLAQALGAMMVWDSAI
TVARGFTYEETRDGVLGRILVRREPVGVVAAVVPWNVPQFVAAAKLAPALLTGCTVVLKP
SPESPLDAYILADITKEAGLPEGVLSILPADREVSEYLVGHPGVDKVSFTGSVAAGKRVM
EVASRNLTRLTLELGGKSAAVVLPDADVETTVAGVVPAAWMNNGQACVAQTRILLPRSRY
DEFAEAFAAAAGALVVGDPLDPATQVGPLVAERQQRRNLDYIRIGQEEGAKILTGGGRPP
GLDKGWYVEPTLFGDVDNSMRIAREEIFGPVICLLPYGDESEALKIANDSDYGLSGSVWT
ADVERGIEVARGVRTGTYSVNTFSLDMLGPFGGYKSSGLGREFGPEGYGEYLEHKMIHLP
AGWEG
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagctcgtggaacacggacagctgttcatcggcggggagttgaccgaccccctg
ggcaaggacgtcatcgaggtggtctccccgcacaccgaggaggtcatcggacgcgtcccg
cacgcctcgaccggggacgtggaccgggccgtcgccgccgcgcgcaccgccttcgacgag
gggccctggccgcggatgtcgctggaggagcggatcgaggtcgtcggcaggatcaaggac
gcgatcgccgtgcggcacgaggagatcgcgcggatgatctcctccgagaacggctcgccg
tactcctggagcgtcctggcccaggccctcggcgcgatgatggtgtgggactcggcgatc
acggtcgcgcggggtttcacgtacgaggagacccgcgacggagtcctcggccgcatcctc
gtccggcgcgaaccggtcggtgtcgtcgccgccgtggtgccgtggaacgtcccgcagttc
gtggccgccgccaagctcgcccccgccctgctcaccggctgcacggtggtgctcaagccg
tcgcccgagtcgccgctggacgcctacatcctggccgacatcacgaaggaggccgggctg
ccggagggcgtcctgtccatcctccccgccgaccgcgaggtcagcgagtacctggtcggg
caccctggcgtggacaaggtctccttcaccggctcggtcgcggccggcaagcgcgtgatg
gaggtggcctcccgcaacctcacccgtctcaccctggaactgggcggcaagtcggcggcg
gtcgtcctgccggacgcggacgtcgagacgacggtggccggggtcgtcccggcggcctgg
atgaacaacggacaggcctgtgtggcccagacccgcatcctgctgccgcgctcgcgctac
gacgagttcgccgaggccttcgcggcggcggcaggcgccctcgtcgtcggcgacccgctg
gacccggcgacccaggtcggcccactcgtcgccgaacgccagcagcggcgcaacctcgac
tacatccgcatcggccaggaggagggcgcgaagatcctcaccggcggcggacgcccgccc
ggcctggacaagggctggtacgtcgagccgaccctcttcggcgacgtcgacaactccatg
cgcatagcccgcgaggagatcttcggacccgtgatctgtctcctgccctacggtgacgag
tccgaggcgctgaagatcgcgaacgactccgactacggcctgagcggcagcgtgtggacg
gcggacgtggagcgcggcatcgaggtggcccgcggggtccgtaccgggacgtactcggtg
aacaccttcagcctcgacatgctgggcccgttcggcggctacaagagctctggcctggga
agggagttcgggccggaagggtacggcgagtacctggagcacaagatgatccatctgccg
gccggctgggagggctga

DBGET integrated database retrieval system