KEGG   Streptomyces lincolnensis: SLINC_2914Help
Entry
SLINC_2914        CDS       T04801                                 

Definition
(GenBank) neuramidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
sls  Streptomyces lincolnensis
Pathway
sls00511  Other glycan degradation
sls00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:sls00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    SLINC_2914
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SLINC_2914
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:sls02042]
    SLINC_2914
Enzymes [BR:sls01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     SLINC_2914
Bacterial toxins [BR:sls02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   SLINC_2914
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 BNR_3 BNR
Motif
Other DBs
NCBI-ProteinID: ANS65138
UniProt: A0A1B1M928
LinkDB All DBs
Position
complement(3453626..3454831)
Genome map
AA seq 401 aa AA seqDB search
MIPLSRTLLAAAVLLTPLTTTGHTAPTRGCAASVPYAAGEGGYDAYRIPAALTTPRGTVL
AFAEGRHDGAGDTGNIDVVLRRSADGGCTWGPPTVVAAGGGDTRGNPAPVVDPATGAIVL
VTCSNSGAVTEAQIMRGEATPEQGRRVFVQHSWDDGRSFTPPYDITDQVKPAHWRWYATG
PGHAVALTGGPHAGRLVVPANHSAAPPAGSADTGQEPRYYGGHALYSDDGGGSWQLGFVD
SSYDGRTNANESSAAQLPDGRLYFGSRDQHGTVPGHRLDAHSGDGGASLDRPYAVQPALN
DVPVVQASVLQLPGPDAPLLFSGPSVPTARRAMALWRSDDGGRTFAKALTLSEQPAAYSD
LVALDRDTVGVLYETGTTGPYASIEFRRLPVGEVMGRPRVV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgatccccctgagccgcacactcctcgccgccgccgtcctcctgaccccgctcaccacc
accggccacaccgccccgacccggggatgcgccgcctcggtgccctacgccgccggggag
ggcggctacgacgcctaccgcatccccgccgccctcaccacaccccggggcacggtcctc
gccttcgccgagggacgccacgacggagccggggacaccgggaacatcgacgtcgtcctg
cgccgctccgccgacggcggctgcacctggggcccgccgacggtcgtggccgccgggggc
ggcgacacccggggcaacccggcgcccgtggtcgatcccgccacgggtgcgatcgtcctc
gtcacctgctccaacagcggggccgtcaccgaggcgcagatcatgcggggcgaggccacc
ccggagcagggccgccgggtgttcgtgcagcacagctgggacgacggccgcagcttcacc
ccgccgtacgacatcacggaccaggtgaaacccgcgcactggcgctggtacgcgaccggc
ccgggccacgccgttgccctgaccgggggcccgcacgccggacgcctggtggtcccggcg
aaccactccgcggccccgcccgcgggctccgccgacacgggtcaggagccccggtactac
ggcggccacgccctctacagcgacgacggcggcggaagctggcagctcggcttcgtggac
tcctcctacgacggccgcaccaacgccaacgagtcctcggccgctcaactccccgacggc
cgcctctacttcggctcccgcgaccagcacggcaccgtccccggccaccggctcgacgcg
cactccggcgacggcggcgcgagcctggaccggccctacgccgtgcagcccgccctgaac
gacgtgccggtggtgcaggccagcgtcctccaactccccggcccggacgccccgttgctg
ttctccggaccgtcggtgccgaccgcgcgccgggccatggcgctctggcgcagcgacgac
ggcggacggaccttcgccaaggcactgaccctgtccgaacagcccgccgcctactcggac
ctggtggcgctcgaccgggacacggtcggcgtgctgtacgagacggggacgaccggaccg
tacgcctcgatcgagttccggcggctgccggtcggggaggtgatgggtcggccgcgtgtc
gtctag

DBGET integrated database retrieval system