KEGG   Streptomyces lincolnensis: SLINC_3549Help
Entry
SLINC_3549        CDS       T04801                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sls  Streptomyces lincolnensis
Pathway
sls00620  Pyruvate metabolism
sls00680  Methane metabolism
sls01100  Metabolic pathways
sls01120  Microbial metabolism in diverse environments
sls01200  Carbon metabolism
Module
sls_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sls00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SLINC_3549
  09102 Energy metabolism
   00680 Methane metabolism
    SLINC_3549
Enzymes [BR:sls01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     SLINC_3549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ANS65773
UniProt: A0A1B1MB97
LinkDB All DBs
Position
complement(4228412..4231153)
Genome map
AA seq 913 aa AA seqDB search
MSSADDQTVSQMTTSSELRADIRRLGDLLGETLVRQEGPELLELVEKVRRLTREDGEAAA
ELLRGTELQTAAKLVRAFSTYFHLANVTEQVHRGRELRARRAAEGGLLARTADRLKDADP
EHLRQTVANLNVRPVFTAHPTEAARRSVLNKLRRIAALLETPVIASDRRRHDTRLAENID
LVWQTDELRVVRPEPADEARNAIYYLDELHAGAVGDVLEDLTAELERVGVRIPDDTRPLT
FGTWIGGDRDGNPNVTPQVTWDVLILQHEHGINDALEMIDELRGFLSNSIRYTGATDELL
DSLGTDLERLPEISPRYKRLNAEEPYRLKATCIRQKLENTKTRLAKGIPHQEGRDYLGTG
ELLADLTLIQTSLREHRGGLFADGRLDRTIRTLGAFGLQLATMDVREHADAHHHALGQLF
DRLGEESWRYVDMPREYRAKLLAKELRSRRPLGPTPAPVDAAGEKTLGVFQTVKRALEVF
GPEVIESYIISMCQGADDVFAAAVLAREAGLVDLHAGWARIGIVPLLETTDELKAADTIL
EDMLSDPSYRRLVALRGDVQEVMLGYSDSSKFGGITTSQWEIHRAQRRLRDVAHRYGVRL
RLFHGRGGTVGRGGGPSHDAILAQPWGTLEGEIKVTEQGEVISDKYLVPSLARENLELTV
AATLQASALHTAPRQSDEALARWDAAMDVVSDAAHAAYRRLVEDPDLPTYFLASTPVDQL
ADLHLGSRPSRRPGSGVSLDGLRAIPWVFGWTQSRQIVPGWFGVGSGLKALREAGLDTVL
DEMHEQWHFFRNFISNVEMTLAKTDLRIAQHYVDTLVPDELKHVFDTIRAEHELTVREVL
RVTGEQELLDATPVLKQTFTIRDAYLDPISYLQVTLLKRQRDAAAAGESPDPLLSRALLL
TVNGVAAGLRNTG
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagtgccgacgaccagactgtgtcccagatgaccaccagtagtgagttgcgagcc
gacatcaggcgactgggcgatctcctgggcgagacccttgtccgccaggagggtcccgag
ctgctcgaactggtcgagaaggtccgccgcctcacccgcgaggacggtgaggcagccgcc
gagctgctgcgcggcaccgaactccagaccgcggccaagctggtccgcgccttctccacc
tacttccacctggccaacgtcaccgagcaggtccaccggggccgcgaactgcgcgcccgg
cgcgccgccgagggcggcctcctcgcccgcaccgccgaccgcctcaaggacgccgacccc
gagcacctgcgccagacggtcgccaacctcaacgttcgcccggtgttcaccgcccacccc
accgaggccgcccgccgttcggtcctcaacaagctccgccgcatcgccgcgctccttgag
accccggtcatcgcgtcggaccgccgccgccacgacacccgcctcgccgagaacatcgac
ctcgtctggcagaccgacgaactgcgtgtcgtccgccccgagcccgccgacgaggcccgc
aacgccatctactacctcgacgaactccacgccggcgccgtcggcgacgtcctggaggac
ctgacggccgaactggagcgcgtcggcgtcaggatccccgacgacacccgccccctgacc
ttcggcacctggatcggcggcgaccgcgacggcaaccccaacgtcaccccccaggtcacc
tgggacgtcctgatcctccagcacgagcacggcatcaacgacgccctggagatgatcgac
gagctgcgcggcttcctgtcgaactccatccgctacaccggcgccaccgacgagctcctg
gactccctcggcaccgacctggagcgcctgccggagatcagcccccgctacaagcgcctc
aacgccgaggagccctaccggctcaaggccacctgcatccggcagaagctggagaacacc
aagacgcgcctggccaagggcatcccgcaccaggagggccgcgactacctcggcaccggc
gaactgctggcggacctcaccctgatccagacctcgctgcgcgagcaccgcggcggcctg
ttcgccgacggccgcctggaccgcaccatccgcaccctgggcgccttcggcctccagctc
gccaccatggacgtacgcgagcacgccgacgcccaccaccatgccctcggccagctcttc
gaccgcctcggcgaggagtcctggcggtatgtggacatgccccgcgagtaccgggccaag
ctgctcgccaaggaactgcgctccaggaggccgctgggcccgaccccggcgcccgtcgac
gcggccggcgagaagaccctcggcgtcttccagaccgtcaagcgggccctggaggtcttc
ggacccgaggtcatcgagtcgtacatcatttcgatgtgccagggggcggacgatgtgttc
gccgccgccgtgctggcccgcgaggccggcctcgtcgacctgcacgccggctgggccagg
atcggcatcgtgccgctcctggagaccacggacgagctcaaggccgccgacacgatcctg
gaggacatgctctccgacccctcctaccggcggctcgtcgccctgcgcggggacgtccag
gaggtcatgctcggctactccgactcctccaagttcggcggtatcaccaccagccagtgg
gagatccaccgcgcccagcgccgcctgcgcgacgtggcacaccgctacggcgtgcggctg
aggctcttccacggccgcggcggcaccgtcggccgcggcggcggcccctcccacgacgcg
atcctcgcccagccctggggcaccctggagggcgagatcaaggtcaccgagcagggcgag
gtcatctccgacaagtacctcgtgccgtcgctggcccgggagaacctggaactcacggtc
gccgccaccctccaggcctccgccctgcacaccgccccccgccagtccgacgaggccctg
gcccgctgggacgcggcgatggacgtcgtctccgacgccgcgcacgccgcgtaccgcagg
ctcgtcgaggacccggacctgccgacgtacttcctcgcgtcgacgccggtggaccagctc
gccgacctgcacctcggctcacggccctcccgccgccccggctcgggcgtctccctcgac
ggactgcgcgccatcccgtgggtgttcggctggacccagtcgcggcagatcgtgccgggc
tggttcggtgtgggctccggcctgaaggcgctgcgggaagccggtctcgacaccgtgctc
gacgagatgcacgaacagtggcacttcttccgcaacttcatctccaacgtcgagatgacg
ctcgccaagaccgacctgcggatcgcccagcactacgtcgacaccctcgtccccgacgag
ctcaagcacgtgttcgacaccatcagggccgaacacgaactcaccgtccgcgaggtcctg
cgcgtcaccggcgaacaggaactcctcgacgccaccccggtcctcaagcagaccttcacc
atccgcgacgcctacctggacccgatctcctacctccaggtcaccctcctcaagcgccag
cgcgacgccgcggccgccggcgagagccccgacccgctgctgtccagggccctgctcctg
acggtcaacggcgtggccgcgggcctgcgcaacaccggctga

DBGET integrated database retrieval system