KEGG   Streptomyces lincolnensis: SLINC_4428
Entry
SLINC_4428        CDS       T04801                                 

Definition
(GenBank) 2-amino-3,7-dideoxy-D-threo-hept-6-ulosonate synthase
  KO
K18287  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase [EC:4.1.2.56]
Organism
sls  Streptomyces lincolnensis
Pathway
sls00997  Biosynthesis of various secondary metabolites - part 3
sls01100  Metabolic pathways
sls01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sls00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    SLINC_4428
Enzymes [BR:sls01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.56  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase
     SLINC_4428
SSDB
Motif
Pfam: DeoC NMO
Other DBs
NCBI-ProteinID: ANS66652
UniProt: A0A1B1ME31
LinkDB
Position
complement(5277808..5278575)
AA seq 255 aa
MPLDHSVSDGPVAPAGQWENLLRALVAGGADGIIVHKGRARGLAPEILKDCALVVHLSAS
TACSADVDAKVLVGDVEEALALGADAVSVHVNLGSDTERQQLADLGAVARSCDTWGMPLI
AMVYPRGPRIDDPRDPALLAHLVNVAADLGADMVKTSVALPLERMAEVVAHSPIPVLAAG
GPPDGSDLVEYGAAVMASGCRGLAVGRRIFSSPSPATLVSRLAAVVHGDARTSGDMSMTD
DEVGSPYSTIVAGVA
NT seq 768 nt   +upstreamnt  +downstreamnt
gtgcctctcgaccacagcgtgtcggacggcccggtcgcccccgccgggcagtgggagaac
ctgctgcgcgccctggtggccgggggcgccgacgggatcatcgtccacaagggccgggcc
cgcggcctcgccccggagatcctgaaggactgcgcgctggtggtgcatctgagcgccagt
acggcatgctccgccgacgtcgacgccaaggtgctggtcggtgatgtcgaggaggccctc
gcgctcggcgcggacgcggtcagcgtccatgtgaacctcggctcggacaccgagcggcag
cagctggccgacctcggggcggtggcccgctcctgcgacacctgggggatgccgctgatc
gcgatggtctatccgcgcggcccccgcatcgacgacccgcgcgatcccgccctcctcgcg
catctggtcaacgtggccgcggatctgggcgccgacatggtgaagacctccgtcgccctg
ccgctggagcggatggccgaggtggtggcccacagtcccatccccgtcctcgcggccggc
ggcccgcccgacggctccgacctcgtggagtacggcgcggcggtgatggcctccggctgc
cgcggactggccgtcggccgccggatcttctcctcaccctcccccgcgacactggtgtcc
cggctggcggctgtggtgcacggcgatgcccggacttcgggtgacatgagcatgaccgac
gatgaagtcggctccccctactcgacgatcgtggcaggtgtcgcatga

DBGET integrated database retrieval system