KEGG   Streptomyces lincolnensis: SLINC_4601Help
Entry
SLINC_4601        CDS       T04801                                 

Definition
(GenBank) hydrolase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
sls  Streptomyces lincolnensis
Pathway
sls00380  Tryptophan metabolism
sls01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sls00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    SLINC_4601
Enzymes [BR:sls01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     SLINC_4601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ANS66825
UniProt: A0A1B1MDX1
LinkDB All DBs
Position
5491735..5492955
Genome map
AA seq 406 aa AA seqDB search
MSEPVSELAFKARELDAGDELAGVRSRFVLDDVVYLDGNSLGALPAGVPERVDDVVRRQW
GELRIRSWEESGWWTAPERIGDRIAPLVGAAAGQVVVGDSTSVNVLKALVGAVRLARLDG
SVRDEIVADATTFPTDGYIAESAARLTGCTLRPVAPERVPQVLGGRTAAVLLNHVDYRSG
RLHDLPALTDAVHAVGAVVVWDLCHSAGALPVGLDEHGVDLAVGCTYKYLNGGPGSPAYL
YVRREIQDRFDSPLPGWNSHAEPFGMRPDYEPAAGALRGRVGTPDILSMLALEAALDVWD
GVSIEAVRAKSLALTDFFVQCVAARVPQGRLELVTPVAHRERGSQIALRCEDAGEVMKRL
IERGVVGDFRHPDVLRFGFTPLYVGFGDVERAARVLGEVLAEPRRT
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaacctgtctccgaactcgctttcaaggcacgggagctggacgcgggggacgag
ctcgccggcgtgcgttcgcggttcgttctcgatgatgtcgtgtacctggacgggaactcg
ctgggcgccctgcccgccggtgtcccggagcgtgtcgacgatgtcgtacgacggcagtgg
ggcgagctgcggatccggtcctgggaggagagcgggtggtggaccgcgcccgagcgcatc
ggtgaccggatcgctccgctggtgggtgccgcggccgggcaggtcgtggtcggggactcg
accagtgtcaatgtcctcaaggcactggtgggtgccgtgcggctggcgcggctcgacggg
tcggtgcgggacgagatcgtggccgacgccaccacctttcccacggacgggtacatcgcc
gagtccgccgccaggctgaccgggtgcaccctgcgcccggtcgctccggagcgggtgccg
caggtgctgggcgggcgcaccgccgccgtgctgctgaaccacgtcgactaccgctccggg
cggctgcacgacctgcccgcgctcacggacgccgtgcacgcggtgggcgcggtggtggtc
tgggatctgtgccacagcgcgggcgccctgccggtcgggctcgacgagcacggcgtcgat
ctggccgtcggctgcacctacaagtacctgaacggcgggccgggttcaccggcctatctg
tatgtgcggcgcgagatacaggaccggttcgactccccgctgcccgggtggaactcgcat
gccgagcccttcgggatgcggcccgactacgaaccggcggcgggcgcgctccgggggcgg
gtcggtacccccgacatcctctccatgctggccctggaggcggccctggacgtgtgggac
ggggtgtcgatcgaggccgtacgggccaagtccctcgccctgacggacttcttcgttcag
tgcgtggcggcccgagtgccccaaggacgcctggagttggtgaccccggtggcccaccgg
gagcggggcagccagatcgcgctgcgctgcgaggacgccggggaggtcatgaagcggctg
atcgagcggggcgtggtgggcgacttccggcacccggacgtcctgcgcttcgggttcacg
ccgttgtacgtcgggttcggcgatgtggagcgggcggcgcgggtgttgggggaggtgctg
gccgagccccggcggacgtag

DBGET integrated database retrieval system