KEGG   Streptomyces lincolnensis: SLINC_5463
Entry
SLINC_5463        CDS       T04801                                 

Definition
(GenBank) aldolase
  KO
K18287  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase [EC:4.1.2.56]
Organism
sls  Streptomyces lincolnensis
Pathway
sls00997  Biosynthesis of various secondary metabolites - part 3
sls01100  Metabolic pathways
sls01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sls00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    SLINC_5463
Enzymes [BR:sls01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.56  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase
     SLINC_5463
SSDB
Motif
Pfam: DeoC Oxidored_nitro
Other DBs
NCBI-ProteinID: ANS67687
UniProt: A0A1B1MGP3
LinkDB
Position
6506246..6507067
AA seq 273 aa
MTDNASFARQLRLRRLYRHGDNRLLVVPLDHSVTDGPVTGGRRVNQLVGRLAGAGADAVV
LHKGALRYVDSQWFTRTSLILHLSASTTHAPDPDAKYLVAGVAEAVRLGADAVSVHVNLG
SASEARQIEDLARISADCDTWSMPLLVMIYPRGPRIAAPADPELLAHAITLAADLGADIV
KTACPARPQDLAEATAHSPVPVLVAGGPPRAHPSEVLSYVSDALSGGAAGVAMGRSIFQS
DDPGALTARLADLIHRPASDAELARIDLLQTAI
NT seq 822 nt   +upstreamnt  +downstreamnt
atgaccgacaacgcttccttcgcccggcagttgcgccttcgccggctgtaccgccacggc
gacaaccggctccttgtcgtaccgctcgaccattcggtgaccgacggaccggtcacgggc
ggccgccgggtcaaccagctcgtcggccggctggccggagccggcgcggacgcggtggtg
ctgcacaaaggggctctccgctacgtggacagccagtggttcacccgcacctcgctcatc
ctccacctgagcgccagcaccacgcacgcgcccgacccggacgccaagtacctggtggcc
ggggtggccgaggccgtacggctcggtgccgacgcggtcagtgtgcatgtgaacctcggc
tccgcctccgaagcccggcagatcgaggatctggcccggatctccgcggactgcgacacc
tggagcatgccgctgctggtcatgatctacccgcggggtccccggatcgccgccccggcc
gaccccgagctcctcgcgcacgccatcaccctcgcggccgacctgggcgcggacatcgtc
aagaccgcctgccccgcccgcccgcaggacctggccgaggccaccgcgcacagcccggtc
cccgtcctcgtggccggcggcccgccgcgcgcgcacccgtccgaggtcctctcctatgtg
tccgacgcgctcagcggcggagctgccggggtcgccatgggacgcagcatcttccagtcc
gacgaccccggcgcgctcaccgcccggctcgccgacctcatccaccgcccggccagtgat
gcggagctggcccggatcgacctccttcagacggcgatctga

DBGET integrated database retrieval system