KEGG   Streptomyces lincolnensis: SLINC_5523Help
Entry
SLINC_5523        CDS       T04801                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
sls  Streptomyces lincolnensis
Pathway
sls00790  Folate biosynthesis
sls01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sls00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SLINC_5523
Enzymes [BR:sls01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SLINC_5523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ANS67747
UniProt: A0A1B1MGV9
LinkDB All DBs
Position
complement(6578591..6579451)
Genome map
AA seq 286 aa AA seqDB search
MLRLGRREFGAHEPVIMAIVNRTPDSFYDQGATFRDEPALARVEQAVAEGAAVIDIGGVK
AGPGEEVSAEEEARRTVGFVAEVRRRFPDVVISVDTWRASVGEAVCEAGADLLNDAWGGV
DPGLAEVAARYGVGLVCTHAGGAEPRTRPHRVTYDDVMADILRVTVGLAERAVSLGVPRE
SVLIDPGHDFGKNTRHSLEATRRLGEMVETGWPVLVSLSNKDFVGETLDKPVKERVVGTL
ATTAVSAWLGAQVYRVHEVAETRQVLDMVASIAGHRPPAVARRGLA
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgctcaggctgggcaggcgtgaattcggcgctcatgagccggtgatcatggcgatcgtg
aaccgcacccccgactccttctacgaccagggggcgaccttccgcgacgagcccgccctc
gcgcgcgtggagcaggcggtggccgagggcgccgccgtcatcgacatcggcggggtcaag
gccggaccgggcgaggaggtgtccgccgaggaggaggcgcggcggaccgtcggtttcgtg
gccgaggtgcggcggcgcttccccgatgtcgtcatcagcgtggacacctggcgggcctcg
gtcggtgaggcggtgtgcgaggccggggcggatctgctgaacgacgcgtggggtggggtg
gatccgggtctcgcggaggtcgccgcgcggtacggggtggggctggtgtgcacgcacgcg
ggtggtgcggagccgcggacccggccgcaccgggtgacgtacgacgacgtcatggccgac
atcctgcgggtgacggtggggctggccgagcgggccgtgtcgctcggggtgccgcgggag
tcggtgctgatcgatcccgggcacgacttcgggaagaacacgcggcacagtctggaggcg
actcgacggctcggggagatggtggagacggggtggccggtgttggtgtcgctgtccaac
aaggacttcgtgggggagacgttggacaagccggtgaaggagcgggtggtggggacgctg
gcgacgacggctgtgtcggcgtggctgggggcgcaggtgtaccgggtgcatgaggtcgcc
gagacgcggcaggtgctggacatggtggcttccatcgctgggcatcggcctccggctgtc
gcccggcgggggctggcgtag

DBGET integrated database retrieval system