KEGG   Streptomyces lincolnensis: SLINC_5684Help
Entry
SLINC_5684        CDS       T04801                                 

Definition
(GenBank) alpha-ketoglutarate decarboxylase
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
sls  Streptomyces lincolnensis
Pathway
sls00020  Citrate cycle (TCA cycle)
sls00310  Lysine degradation
sls00380  Tryptophan metabolism
sls01100  Metabolic pathways
sls01110  Biosynthesis of secondary metabolites
sls01120  Microbial metabolism in diverse environments
sls01130  Biosynthesis of antibiotics
sls01200  Carbon metabolism
Module
sls_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sls_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sls00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SLINC_5684
  09105 Amino acid metabolism
   00310 Lysine degradation
    SLINC_5684
   00380 Tryptophan metabolism
    SLINC_5684
Enzymes [BR:sls01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     SLINC_5684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh 2-oxoacid_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: ANS67908
UniProt: A0A1B1MH40
LinkDB All DBs
Position
complement(6756846..6760643)
Genome map
AA seq 1265 aa AA seqDB search
MSPQSPSNSSISTDDQAGKNNPAAAFGPNEWLVDEIYQQYLQDPNSVDRAWWDFFADYKP
GAAAAPAPAGTAAAGAAGTTAQPKPAAAPPAQAPTQAAAPAQAPAQAAPAPAAKPAAAAP
AQAAAPAPAKPAAAKPAAKAAAADGPELVTLRGPAAAVAKNMNASLEVPTATSVRAVPVK
LLFDNRIVINNHLKRARGGKISFTHLIGYAMVQAIKAMPSMNYSFAEKDGKPTLVKPEHI
NFGLAIDLVKPNGDRQLVVAGIKKAETLNFFEFWQAYEDIVRRARDGKLGMDDFTGVTVS
LTNPGGLGTVHSVPRLMPGQSVIMGVGSMDYPAEFQGTSQDTLNKLGISKVMTLTSTYDH
RVIQGAASGEFLRIVANLLLGEGGFYDDIFEALRIPYEPVRWLKDIDASHDDDVTKAARV
FELIHSYRVRGHVMADTDPLEYRQRKHPDLDITEHGLTLWDLEREFAVGGFAGKSLMKLR
DILGVLRDSYCRTTGVEFMHIQDPKQRKWIQDRIERAHTKPEREEQLRILRRLNAAEAFE
TFLQTKYVGQKRFSLEGGESVIPLLDAVIDSAAESRLDEVVIGMAHRGRLNVLANIVGKS
YAQIFREFEGNLDPKSMHGSGDVKYHMGAEGVFTGLDGEQIKVSLAANPSHLEAVDPVLE
GVVRAKQDVINKGGTDFTVLPVALHGDAAFAGQGVVAETLNMSQLRGYRTGGTVHVVINN
QVGFTAAPESSRSSMYSTDVARMIEAPIFHVNGDDPEAVVRVARLAFEFRQAFNKDVVID
LICYRRRGHNESDNPAFTQPLMYDLIDKKRSVRKLYTESLIGRGDITLEEAEQALQDYQG
QLEKVFTEVREATSQPASAEPSDPQAEFPVAVNTAVTAEVVKRIAESQVNVPDHITVHPR
LLPQLQRRASMVEDGTIDWGMGETLAVGSLLLEGVPVRLSGQDSQRGTFGQRHAVIIDRE
TGEEFTPLMYLSEEQARYNVYNSLLSEYAVMGFEYGYSLARPDALVMWEAQFGDFVNGAQ
TVVDEFISSAEQKWSQTSGVVLLLPHGYEGQGPDHSSARPERFLQLCAQNNMTVATPTSP
SNYFHLLRWQVHNPHHKPLIVFTPKSMLRLKAAASSADEFTTGQFRPVIGDASVDPAAVK
KVVFTAGKVYYDLDAERKKRGVTDTAIIRLERLYPLPGAEVQAEIAKYPNAEKYLWAQEE
PANQGAWPFIALNLIDHLDLAVGAEVPHGERLRRISRPHSSSPAVGSAKRHQAEQEQLVR
EVFEA
NT seq 3798 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgccacagtcccccagtaactcgagcatctcgaccgacgaccaagccgggaagaac
aaccccgctgccgcgttcggtcccaacgagtggctcgtcgatgagatctatcagcagtac
ctccaggacccgaattcggtagaccgagcctggtgggacttcttcgccgactacaagccg
ggcgcggccgccgccccggctccggcgggtaccgcggccgcgggggccgcgggcaccacc
gctcagcccaagcctgccgccgccccgccggcccaggcgcccacgcaggccgcagcgccc
gcgcaggctccggctcaggccgctccggcgcccgccgcgaagcccgcggccgccgctccg
gcgcaggccgccgccccggctcccgcgaagcccgccgccgccaagccggcggcgaaggcc
gcggccgccgacggtcccgagctggtgacgctgcgcggccccgccgccgcggtcgcgaag
aacatgaacgcctcgctggaggtgcccacggccacgtccgtgcgcgcggtcccggtgaag
ctgctcttcgacaaccgcatcgtcatcaacaaccacctcaagcgcgcccggggcgggaag
atctccttcacgcacctgatcgggtacgcgatggtgcaggccatcaaggccatgccgtcg
atgaactactccttcgcggagaaggacggcaagccgaccctggtcaagccggagcacatc
aacttcggcctcgccatcgacctggtgaagcccaacggcgaccgtcagctggtcgtcgcg
ggcatcaagaaggccgagacgctgaacttcttcgagttctggcaggcctacgaggacatc
gtccgccgcgcccgcgacggcaagctgggcatggacgacttcaccggtgtgacggtctcc
ctgaccaaccccggcggcctcggcaccgtccactcggtgccgcgtctgatgcccggccag
tcggtcatcatgggcgtcggctcgatggactacccggcggagttccagggcaccagccag
gacacgctcaacaagctcggcatctcgaaggtcatgacgctcacgtcgacctacgaccac
cgggtcatccagggtgccgcctccggcgagttcctgcggatcgtcgcgaacctcctcctc
ggcgagggcggcttctacgacgacatcttcgaggccctgcgcatcccctacgagccggtc
cgctggctcaaggacatcgacgcctcgcacgacgacgacgtcaccaaggccgcgcgcgtc
ttcgagctgatccactcctaccgggtccgcggccacgtcatggccgacaccgacccgctg
gagtaccgccagcgcaagcaccccgacctcgacatcaccgagcacggtctgacgctgtgg
gacctggagcgcgagttcgccgtcggcggcttcgccggcaagtccctgatgaagctgcgc
gacatcctcggcgtgctgcgcgactcgtactgccgcaccaccggcgtcgagttcatgcac
atccaggaccccaagcagcgcaagtggatccaggaccgcatcgagcgcgcgcacaccaag
ccggagcgcgaggagcagctgcgcatcctgcgccgcctgaacgcggcggaggccttcgag
accttcctccagacgaagtacgtaggccagaagcgcttctcgctcgaaggcggcgagtcg
gtcatcccgctgctggacgcggtcatcgacagcgcggcggagtcccgcctcgacgaggtc
gtcatcggcatggcccaccgcggccggctgaacgtcctggcgaacatcgtcggcaagtcg
tacgcccagatcttccgcgagttcgagggcaacctcgacccgaagtcgatgcacggctcc
ggcgacgtgaagtaccacatgggcgccgagggcgtgttcaccggtctggacggcgagcag
atcaaggtctcgctggccgccaacccctcccacctggaggcggtcgacccggtcctggag
ggtgtcgtccgcgccaagcaggacgtcatcaacaagggcggcacggacttcacggtcctg
ccggtggcgctgcacggcgacgcggccttcgcgggccagggcgtggtcgcggagacgctg
aacatgtcgcagctgcgcggctaccgcaccggcggcacggtccacgtggtcatcaacaac
caggtcggcttcacggcggcgcccgagtcctcgcgctcctccatgtactcgaccgacgtg
gcccgcatgatcgaggccccgatcttccacgtgaacggcgacgaccccgaggcggtcgtc
cgcgttgcccggctggccttcgagttccgccaggcgttcaacaaggacgtggtgatcgac
ctcatctgctaccgccgccgcggtcacaacgagtcggacaacccggccttcacccagccg
ctgatgtacgacctgatcgacaagaagcgctcggtgcgcaagctctacaccgagtccctc
atcggtcgcggcgacatcaccctggaagaggccgagcaggctctccaggactaccagggc
cagctggagaaggtcttcacggaggtccgcgaggccacctcccagccggcgtcggccgag
ccgtccgacccgcaggccgagttcccggtcgccgtgaacaccgcggtcaccgcggaggtc
gtcaagcggatcgccgagtcccaggtcaacgtccccgaccacatcaccgtccacccgcgt
ctgctgccgcagctccagcgccgggcgtcgatggtcgaggacggcacgatcgactggggc
atgggcgagaccctcgcggtcggctccctcctgctggagggcgtcccggtccggctgtcc
ggccaggactcccagcgcggtacgttcggccagcgccacgcggtgatcatcgaccgtgag
acgggcgaggagttcacgccgctgatgtacctctcggaggagcaggcgcgttacaacgtc
tacaactccctcctctccgagtacgcggtcatgggcttcgagtacggctactcgctggcg
cgtcccgacgcgctggtgatgtgggaggcccagttcggcgacttcgtcaacggcgcccag
acggtcgtggacgagttcatctcgtcggccgagcagaagtggtcccagacctccggcgtc
gtcctgctcctgccgcacggctacgagggccagggcccggaccactcctcggcccgcccg
gagcgcttcctccagctctgcgcccagaacaacatgacggtcgcgacgccgacctcgccg
tcgaactacttccacctgctgcgctggcaggtgcacaacccgcaccacaagccgctgatc
gtcttcaccccgaagtcgatgctgcgtctgaaggccgcggcgtcctcggcggacgagttc
accaccggccagttccgcccggtcatcggcgacgcttcggtcgacccggccgcggtcaag
aaggtcgtcttcacggccggcaaggtctactacgacctcgacgccgagcggaagaagcgc
ggcgtcacggacacggcgatcatccgcctggagcgcctgtaccccctcccgggtgccgag
gtccaggccgagatcgccaagtacccgaacgccgagaagtacctgtgggcccaggaggag
ccggccaaccagggcgcctggccgttcatcgccctcaacctcatcgaccacctcgacctg
gcggtcggcgcggaggtcccccacggcgagcgcctgcgccgcatctcccgcccgcacagc
tcgtccccggccgtcggttccgcgaagcggcaccaggcggagcaggagcagctggtgcgc
gaggtgttcgaggcgtga

DBGET integrated database retrieval system