KEGG   Streptomyces lincolnensis: SLINC_6816Help
Entry
SLINC_6816        CDS       T04801                                 

Definition
(GenBank) aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sls  Streptomyces lincolnensis
Pathway
sls00250  Alanine, aspartate and glutamate metabolism
sls00410  beta-Alanine metabolism
sls00640  Propanoate metabolism
sls00650  Butanoate metabolism
sls01100  Metabolic pathways
sls01120  Microbial metabolism in diverse environments
Module
sls_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sls00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SLINC_6816
   00650 Butanoate metabolism
    SLINC_6816
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SLINC_6816
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SLINC_6816
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sls01007]
    SLINC_6816
Enzymes [BR:sls01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SLINC_6816
Amino acid related enzymes [BR:sls01007]
 Aminotransferase (transaminase)
  Class III
   SLINC_6816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_5 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ANS69040
UniProt: A0A1B1MK97
LinkDB All DBs
Position
8181994..8183280
Genome map
AA seq 428 aa AA seqDB search
MTKDLLGRHRAVLPDWLALYYEDPLEITHGEGRYVWDAEGTRYLDFFGGILTTMTAHALP
EVTKAVSEQAGRILHSSTLYLNRPMVELAERIAQLSGIPDARVFFTTSGTEANDTALMLA
TTYRRSNTILAMRNSYHGRSFSAVGITGNRGWSPTSLSPLQTLYVHGGVRTRGPYASLSD
DDFIAACVEDLKDLLGHTRPPAALIAEPIQGVGGFTSPPDGLYAAFREVLAEHGILWIAD
EVQTGWGRTGEHFWGWQAHARSGPPDIVTFAKGIGNGMSIGGVVARGEIMNCLDANSIST
FGGTQITMAAGLANLAHLLEHDLQGNARRVGGLLIERLRAVAAQTPGVREVRGRGLMIGI
ELVKPGTDEADPQAASAVLEAARAGGLLIGKGGGHNTSALRLAPPLSLTVAEAEEGAAIL
ESALRSIH
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaaggacctgctgggccgccaccgggccgtcctgcccgactggctcgccctctac
tacgaggaccccctggagatcacgcatggcgagggccggtacgtctgggacgccgagggc
accaggtacctcgacttcttcggcggcatcctcaccacgatgaccgcgcacgccctgccc
gaggtgaccaaggcggtgagcgagcaggccgggcggatcctgcactcctcgaccctgtac
ctgaaccgcccgatggtcgaactcgccgagcggatcgcccagttgagcggcatcccggac
gcccgggtcttcttcaccacctcgggcacggaggccaacgacacggccctgatgctggcg
acgacctaccgccgcagcaacacgatcctggcgatgcgcaacagctaccacggccgctcc
ttcagcgcggtcggcatcaccggcaaccgcggctggtcgcccacctcgctgtccccgctc
cagacgctctacgtccacggcggcgtgcgcacgcgcggcccgtacgcctccctcagtgac
gacgacttcatcgcggcctgcgtcgaggacctgaaggacctgctcggccacacccgccca
cccgcggccctgatcgccgaaccgatccagggcgtcggcgggttcacctcaccgccggac
ggcctgtacgcggccttccgcgaggtgctggccgagcacggcatcctgtggatcgccgac
gaggtgcagaccggctggggccgcaccggcgaacacttctggggctggcaggcccatgcg
cgcagcggcccgccggacatcgtcaccttcgccaagggcatcggcaacggcatgtccatc
ggcggggtcgtggcgcgcggcgagatcatgaactgcctggacgccaacagcatctcgacc
ttcggcggcacccagatcaccatggcggccggactcgccaacctcgctcacctgctggag
cacgacctccagggcaacgcccggcgcgtcggcggactgctcatcgagcggctgcgggcc
gtcgccgcgcagaccccgggtgtacgggaggtgcgcggccgggggctcatgatcggcatc
gagctggtcaaacccggcacggacgaggccgacccgcaggccgcgagcgccgtactcgaa
gcggcccgcgcgggcgggctgctcatcggcaagggcggcggccacaacaccagcgccctg
cgcctcgcaccgcccctgtccctcaccgtcgcggaggccgaggaaggcgccgcgatcctc
gagagcgctctgaggagcatccactag

DBGET integrated database retrieval system