KEGG   Streptomyces lincolnensis: SLINC_6891Help
Entry
SLINC_6891        CDS       T04801                                 

Definition
(GenBank) putative cyclase/dehydrase
  KO
K05554  aromatase [EC:4.2.1.-]
Organism
sls  Streptomyces lincolnensis
Pathway
sls01056  Biosynthesis of type II polyketide backbone
sls01100  Metabolic pathways
sls01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sls00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01056 Biosynthesis of type II polyketide backbone
    SLINC_6891
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sls01004]
    SLINC_6891
   01008 Polyketide biosynthesis proteins [BR:sls01008]
    SLINC_6891
Enzymes [BR:sls01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-  
     SLINC_6891
Lipid biosynthesis proteins [BR:sls01004]
 Polyketide synthase
  Component type
   SLINC_6891
Polyketide biosynthesis proteins [BR:sls01008]
 Polyketide synthase (PKS)
  Type II PKS
   C7-C12 cyclized polyketide type
    Octaketide PKS
     SLINC_6891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polyketide_cyc2 Polyketide_cyc
Motif
Other DBs
NCBI-ProteinID: ANS69115
UniProt: A0A1B1MKH0
LinkDB All DBs
Position
complement(8272255..8273205)
Genome map
AA seq 316 aa AA seqDB search
MPSELHESGHEIKISAPAETVYGLLARAEDWPRLFPPNIHVEQVECGEHEERIRIWATAG
DTVKNWTSHRRLDPEHLRIRFRQEITAPPVAAMGGEWHVEALPSGESVVRLAHDYRAADS
ASLAWLHDVVDRNSRSELDSLKSLAESPADDGLTCSFEDTVRIRGEVGDVYDFIDRADLW
TERLPHVLAVRLQEPAPGLQTLEMDTLAKDGSSHTTKSYRVGLPPHRIVYKQVTLPALLT
LHTGRWTIVPADGGGVTASSQHTFTIDPDAVEKVLGAGATVPDAVAYARTALSTNSLATL
SLAREHAERRAEGARP
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgccctccgagctgcacgagtccggacacgagatcaagatctccgcaccggccgagacc
gtctacggcctgctggcccgggccgaggactggccccggctcttccccccgaacatccat
gtcgaacaggtcgagtgcggtgagcacgaggaacgcatccgcatctgggcgaccgcgggc
gacaccgtcaagaactggacctcgcaccgccgcctggacccggagcacctgcgcatccgc
ttccgccaggagatcaccgcgcccccggtggccgcgatgggcggcgagtggcacgtcgag
gccctgccctccggggagtcggtggtgcgcctggcacacgactaccgggcggccgacagc
gcgagcctcgcctggctccacgacgtggtcgaccgcaactcccgctcggagctggactcc
ctcaagtccctcgccgagtcccccgccgacgacggcctgacctgctccttcgaggacacg
gtccggatccggggcgaggtcggggacgtctacgacttcatcgaccgggcggacctgtgg
accgagcgcctgccgcatgtcctcgcggtacggcttcaggagccggcgccgggactccaa
acgctggagatggacaccctggccaaggacggcagttcccacaccaccaagtcgtaccgc
gtcgggctgccgccgcaccggatcgtgtacaagcaggtcaccctgcccgccctgctgacc
ctgcacaccggccgctggacgatcgtcccggccgacggcgggggtgtcacggcctcctcc
cagcacaccttcaccatcgaccccgacgccgtcgagaaggtcctcggggccggtgcgacc
gtgccggacgcggtcgcgtacgcccgtaccgcgctcagcaccaacagcctcgccacgctc
tccctggccagggagcacgcggagcggcgggccgagggcgcgcgaccgtga

DBGET integrated database retrieval system