KEGG   Streptomyces lincolnensis: SLINC_6932Help
Entry
SLINC_6932        CDS       T04801                                 

Definition
(GenBank) catalase HPII
  KO
K03781  catalase [EC:1.11.1.6]
Organism
sls  Streptomyces lincolnensis
Pathway
sls00380  Tryptophan metabolism
sls00630  Glyoxylate and dicarboxylate metabolism
sls01110  Biosynthesis of secondary metabolites
sls01130  Biosynthesis of antibiotics
sls01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sls00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SLINC_6932
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    SLINC_6932
Enzymes [BR:sls01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     SLINC_6932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase_C Catalase-rel DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: ANS69156
UniProt: A0A1B1MKM5
LinkDB All DBs
Position
complement(8310159..8312258)
Genome map
AA seq 699 aa AA seqDB search
MDPADRKQIQRTQYHADDPAQGPLTTDQGVEVDHTDDSLTVGERGPTLMEDFHFREKLTR
FDHERIPERVVHARGAGAYGYFEPYESCAEFTRAAFLQDPAVRTPVFVRFSTVQGPKGSA
DTVRDVRGFATKFYTSEGNYDLVGNNFPVFFIQDGIKFPDFVHAVKPEPHNDIPTGASAH
DTLWDFVSLQPETLHAVMWLMSDRAIPRSYRMMQGFGVHTFRFVNAEGRGTFVKFHWKPR
LGVHSLVWDEAQECQGRNPDFNRGDLWDAIEAGEYPEWELGVQLVPEEDEFAFDFDLLDA
TKLIPEEQVPIRPIGRMVLNRNPENFFAETEQVAFHTANVVPGIDFTNDPLLQARNFSYL
DTQLIRLGGPNFTQIPVNRPVAPVRTNQRDGYHQSAIHRGTNYSPNSLGGGCPAHAGADG
HAFTHYTERVDGHTIRRRSPSFQDHWSQAALFWNSMADWEKQHIVAAFRFELGKVDALAV
RARTVEQLAKVNGELATQVARGVGVPEPAAQETAHKLSSPALSLESLRGDGSIRTRQIAV
LVTDGVDAEQVTSVREPLAAEGAIVEALAAVDGTVAGADGERYTVDRALPTVASVLYDAV
LLPGGPVGTPPTTADPDAMRFVRDAYRHGKPVGALGSGVGILSALQPEGLRLSTEFHRVV
SDQGVVTDTSPGTASEEFTRAFVAAIAAHRHWDRPPARC
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atggaccccgccgaccgcaagcagatccagcggacccagtaccacgcggacgacccggcg
cagggaccgctcaccaccgaccagggcgtcgaggtcgaccacaccgacgactcgctgacc
gtgggcgagcgcggcccgaccctgatggaggacttccacttccgggagaagctgacccgc
ttcgaccacgagcggatcccggagcgggtggtgcacgcgcggggtgcgggcgcctacggc
tatttcgaaccgtacgagtcctgcgcggagttcacccgcgcggccttcctccaggacccg
gccgtacggaccccggtgttcgtgcggttctcgaccgtgcagggccccaagggctcggcg
gacaccgtgcgggacgtgcgcggcttcgccaccaagttctatacctccgagggcaattac
gacctggtggggaacaacttcccggtcttcttcatccaggacggcatcaagttccccgac
ttcgtgcacgcggtgaaaccggagccgcacaacgacatccccacgggcgcgtccgcgcac
gacaccctgtgggacttcgtgtcgctccagcccgagaccctgcacgcggtcatgtggctg
atgtcggaccgggcgatcccgcgcagctaccgcatgatgcagggcttcggcgtgcacacc
ttccggttcgtgaacgccgaggggcgcggcacgttcgtgaagttccactggaagccgcgc
ctcggtgtgcactcgctggtgtgggacgaggcgcaggagtgccagggccgcaacccggac
ttcaaccggggtgacctctgggacgccatcgaggccggcgagtacccggagtgggagctg
ggcgtccaactggtgccggaggaggacgagttcgccttcgacttcgatctgctggacgcc
acgaagctcatcccggaggagcaggtgcccatccggccgatcggccggatggtgctgaac
cgcaacccggagaacttcttcgccgagaccgagcaggtcgccttccacaccgccaacgtc
gtcccgggcatcgacttcaccaacgacccgctgctccaggcccgcaacttctcctacctg
gacacgcagttgatccgcctgggcggtcccaacttcacgcagatcccggtgaaccggccg
gtggcgccggtgcgcaccaaccagcgcgacggctaccaccagagcgccatccaccggggc
acgaactactccccgaactccctcggcggcggctgcccggcccacgcgggcgccgacggg
cacgccttcacgcactacaccgagcgcgtggacgggcacacgatccggcggcgcagcccc
agtttccaggaccactggagccaggccgcgctgttctggaacagcatggccgactgggag
aagcagcacatcgtcgcggccttccggttcgagctgggcaaggtcgacgcgctggccgtc
cgggcccgcacggtcgagcaactcgccaaggtgaacggcgagttggccacccaggtggcg
cgtggcgtcggcgtgccggagccggccgcccaggagaccgcgcacaagctgtcctccccc
gcgctcagcctggagtcgctgcgcggcgacggctccatccgcacccggcagatcgcggtc
ctggtcaccgacggtgtggacgccgagcaggtgacgtccgtccgggagccgctggccgcc
gagggcgcgatcgtggaggcgctggcggccgtggacggtacggtggcgggcgccgacggc
gagcggtacaccgtggaccgtgccctgccgaccgtcgcctccgtgctctacgacgcggta
ctgctgcccggcggcccggtgggcaccccgccgacgacggccgaccccgacgcgatgcgc
ttcgtgcgggacgcctaccggcacggcaagccggtgggcgcgctcggctcgggcgtgggc
atcctctccgcgctccagcccgaggggctgcggctgtccaccgagttccaccgcgtggtg
agcgaccagggcgtggtgacggacacctcgccgggaaccgcgagcgaggagttcacccgg
gcgttcgtggccgcgatcgcggcgcaccggcactgggaccggccgccggcgcgctgctga

DBGET integrated database retrieval system