KEGG   Streptomyces lincolnensis: SLINC_7140Help
Entry
SLINC_7140        CDS       T04801                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
sls  Streptomyces lincolnensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ANS69364
UniProt: A0A1B1MLC0
LinkDB All DBs
Position
complement(8572782..8573825)
Genome map
AA seq 347 aa AA seqDB search
MKPMLAKSVASIPPGMHYEAKWDGFRAIVFRDGAEVEVGSRTGKPLTRYFPELVVALEQR
VPERCVLDGEIVIARDGRLDFDALTERIHPAQSRVRTLAERTPSSFVAFDLLALADESLL
DVPLTDRRALLSRALEGVTAPVHVAPATTDIDLATRWFEQYEGAGLDGVVAKPLTGRYLQ
DERAMFKIKHERTADVVVAGYRLHKSGPVVGSLLLGLYDDKGALQHVGVSAAFPMKRRAE
LIEELEPLRMADAAGHPWAAWAEEAAHETARLPGAPSRWSGKKDLSWVPLRPERVAEVAY
DHMENGARFRHTARFRRWRPDRTPDSCTYAQLEEPVRYDLQEILSGP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcccatgctcgccaagtccgtggcgagcatccccccgggcatgcactacgaggcg
aaatgggacgggttccgggccatcgtgttccgcgacggggccgaggtcgaggtcggcagc
cgtaccggtaagccgctgaccaggtactttcccgagctggtcgtggcgttggagcagcgg
gtgccggagcggtgtgtgctggacggggagatcgtcatcgcgcgggacgggcggctggac
ttcgacgcgctgaccgagcgcatccatccggcccagtcccgggtgcggacgctggcggag
cggacgccctcgtcgttcgtcgcgttcgatctgctggccctggcggacgagtcgctgttg
gacgtgcccctgaccgatcggcgggcgctgctcagcagggccctggagggggtgacggca
ccggtgcacgtggcgccggcgaccaccgacatcgacctcgcgacccgctggttcgagcag
tacgagggggccggcctggacggggtcgtcgccaagccgctcaccgggcgctacctccag
gacgagcgcgccatgttcaagatcaagcacgagcgcacggcggacgtcgtcgtggccggt
taccgcctccacaagagcggcccggtcgtcggctcgctgttgctggggctctacgacgac
aagggcgcccttcagcacgtcggcgtgtccgcggccttccccatgaagcggcgggccgag
ctgatcgaggagctggagccgctgcgcatggcggatgccgcggggcatccctgggcggcc
tgggccgaggaggcggcgcacgagacggcccggctgccgggtgcccccagccgctggtcg
ggcaagaaggacctgtcgtgggtgccgctcaggccggagcgggtggccgaggtggcctac
gaccacatggagaacggcgcacggttcaggcacaccgcccgcttccgccgctggcggccg
gaccggacaccggacagctgcacctacgcgcagctggaggagccggtccgctacgacctc
caggagatcctgtcgggcccctga

DBGET integrated database retrieval system