KEGG   Streptomyces lincolnensis: SLINC_7319Help
Entry
SLINC_7319        CDS       T04801                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
sls  Streptomyces lincolnensis
Pathway
sls00020  Citrate cycle (TCA cycle)
sls00480  Glutathione metabolism
sls01100  Metabolic pathways
sls01110  Biosynthesis of secondary metabolites
sls01120  Microbial metabolism in diverse environments
sls01130  Biosynthesis of antibiotics
sls01200  Carbon metabolism
sls01210  2-Oxocarboxylic acid metabolism
sls01230  Biosynthesis of amino acids
Module
sls_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sls_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:sls00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SLINC_7319
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SLINC_7319
Enzymes [BR:sls01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     SLINC_7319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: ANS69543
UniProt: A0A1B1MLX0
LinkDB All DBs
Position
complement(8778577..8780793)
Genome map
AA seq 738 aa AA seqDB search
MTDSTIIYTHTDEAPALATYSFLPVVQAYASQAGVAVQTRDISLAGRIIAVFPEYLTEDQ
RIPDALAELGELAKTPEANIIKLPNISASIPQLKAAVAELQAQGYALPDYPDDPKTDEER
EIQSRYDKIKGSAVNPVLREGNSDRRAPASVKNYAKNHPHRMGAWTSESKTNVATMGVDD
FRSTEKSVVISEAGSLRIELVGDDGSTTVLRESVPVRAGEVVDASVMHVAPLREFLTAQI
ARAKAEGVLFSVHLKATMMKVSDPIVFGHVVRAFFPKTFAKYGEALAAAGLSPNDGLGGI
YKGLEGLPEGAEIKASFDAELAEGPELAMVDSDKGITNLHVPSDVIVDASMPAMIRTSGH
MWGPDGQEADTLAVLPDSSYAGVYQAVIDDCRANGAYDPSTMGSVPNVGLMAQKAEEYGS
HDKTFEVPVTGTVRLVDQNGDAVIEQPVSAGDIFRACQTKDAPIRDWVKLAVTRARATGD
PAVFWLDETRAHDANLIAKVDEYLAEHDTEGLDIRVLAPVEATKLSVERIRRGENTISVT
GNVLRDYLTDLFPILELGTSAKMLSVVPLMAGGGLFETGAGGSAPKHVQQLVKENYLRWD
SLGEFFALVPSLEQFATATGNTRAKVLADTLDRATATFLNEDKSPTRRVGGIDNRGSHFY
LSFYWAQELAQQTEDADLAKAFAPLAETLATNEQKIVDELNAVQGSHAEIGGYYQPDPAK
AAAIMRPSTTWNEALASL
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
gtgactgactcgaccatcatctatacgcacactgacgaggccccggccctggcgacgtat
tccttcctgccggtggtccaggcgtacgcctcgcaggcgggtgtcgccgtgcagacgcgg
gacatctcgctggccgggcgcatcatcgccgtgttcccggagtacctcaccgaggaccag
cggatcccggacgcgctggcggagctgggcgagctggccaagacgcccgaggccaacatc
atcaagctgccgaacatctcggcgtccatcccgcagctcaaggccgccgtcgccgagctt
caggcgcagggctacgcgctgcccgactacccggacgacccgaagaccgacgaggagcgg
gagatccagtcccgctacgacaagatcaagggctccgcggtcaacccggtcctgcgtgag
ggcaactccgaccggcgcgcccccgcctcggtcaagaactacgccaagaaccacccgcac
cgcatgggcgcctggacctccgagtccaagaccaacgtggcgaccatgggcgtggacgac
ttccgctccaccgagaagtccgtcgtgatctccgaggcgggctcgctgaggatcgagctg
gtcggcgacgacggctccaccaccgtcctgcgcgagtcggtaccggtccgcgcgggcgag
gtcgtcgacgcctccgtcatgcacgtcgcgccgctgcgcgagttcctgaccgcgcagatc
gcccgggccaaggccgagggtgtgctgttctccgtgcacctcaaggccacgatgatgaag
gtctccgacccgatcgtcttcggtcacgtggtgcgcgccttcttcccgaagaccttcgcg
aagtacggcgaggcgctggccgcggccggcctgtccccgaacgacggcctgggcgggatc
tacaagggccttgagggcctgccggagggtgccgagatcaaggcgtccttcgacgccgag
ctcgccgagggcccggagctggccatggtcgactccgacaagggcatcaccaacctgcac
gtgccgtccgacgtgatcgtcgacgcctcgatgccggccatgatccgcacctccggccac
atgtggggcccggacggccaggaggccgacaccctcgcggtgctgccggactcctcctac
gccggtgtctaccaggccgtgatcgacgactgccgtgccaacggcgcctacgacccgtcg
accatgggttccgtcccgaacgtcggcctcatggcgcagaaggccgaggagtacggcagc
cacgacaagaccttcgaggtcccggtcacgggcacggtccgcctggtcgaccagaacggc
gacgccgtcatcgagcagccggtctccgccggtgacatcttccgcgcctgccagaccaag
gacgccccgatccgggactgggtgaagctggccgtcacccgcgcccgcgccaccggcgac
ccggcggtgttctggctggacgagacccgcgcgcacgacgccaacctgatcgccaaggtc
gacgagtacctggcggagcacgacaccgagggcctggacatccgtgtcctcgcccccgtc
gaggccaccaagctgtcggtggagcgcatccgccgcggcgagaacaccatctcggtgacc
ggcaacgtcctgcgtgactacctgaccgacctgttcccgatcctggagctgggcaccagc
gccaagatgctgtcggtcgtcccgctgatggcgggcggcggcctgttcgagacgggcgcc
ggcggttccgcgcccaagcacgtccagcagctggtcaaggagaactacctgcgctgggac
tccctcggtgagttcttcgcgctggtcccgtccctggagcagttcgccacggccaccggc
aacacccgggccaaggtcctcgccgacaccctcgaccgcgccacggcgaccttcctcaac
gaggacaagtccccgacccgtcgcgtcggcggcatcgacaaccgcggcagccacttctac
ctctccttctactgggcgcaggagctggcccagcagaccgaggacgccgacctggccaag
gccttcgccccgctcgccgagacgctcgccaccaacgagcagaagatcgtcgacgagctg
aacgccgtccagggcagccacgccgagatcggcggctactaccagcccgacccggccaag
gccgccgcgatcatgcgcccgtcgacgacgtggaacgaggccctcgcctccctctga

DBGET integrated database retrieval system