KEGG   Sideroxydans lithotrophicus: Slit_0266Help
Entry
Slit_0266         CDS       T01196                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
slt  Sideroxydans lithotrophicus
Pathway
slt00620  Pyruvate metabolism
slt00680  Methane metabolism
slt00710  Carbon fixation in photosynthetic organisms
slt01100  Metabolic pathways
slt01120  Microbial metabolism in diverse environments
slt01200  Carbon metabolism
Module
slt_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:slt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Slit_0266
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Slit_0266
   00680 Methane metabolism
    Slit_0266
Enzymes [BR:slt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Slit_0266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 Drf_DAD
Motif
Other DBs
NCBI-ProteinID: ADE10508
UniProt: D5CLC0
LinkDB All DBs
Position
complement(268830..271598)
Genome map
AA seq 922 aa AA seqDB search
MNLISAPADISSKDIPLRDDVRLLGRILGDTLREQEGEETYKLIESVRRAAVRFRKTQDE
QDGELLEQMLDQLSPTETLVVVRAFSYFSQLTNIAEDLHHNRRHRAHLKAGSPPKDGTLQ
LALDRLEEKKIDKDTLQSFLNSALVSPVLTAHPTEVQRKSILDCHLIISSLLANRDRVDM
TPDDLAENEEALHRFVLILWQTRMMRTAKLNVRDEIRNGLEYYHYTFLAEIPKLYANLEK
QLESRFDKDIKVPPLLRVGSWIGGDRDGNPFVTHDVMTDAVREHSILALEYYLNETHLLG
TRLSLTDRLVEVTPELRKLSDASPDNVFVRLDEPYRRALILIYSRLTATAKHLGHDTSHL
RPVDAHAQPYATAQDFIADLDVMIDSLFKHGAVYLARGRLANLRRAVEVFGFYLAPLDMR
QHSAILEQTVSELFSHSSGKANYSDLDEAGKRSVLLEALQSGKILLADIKRYSDVPQSEL
RIMQAAAEIHRRFGHGALPNHIISKTDAVSDMLEVALMLQQFGLLQDGDTLHVNIIPLFE
TIEDLRGGASIMDELFSIPWYRKLLSSRGNTQEVMLGYSDSNKDGGYLTANWELYKAEVE
LVKVFAKHGIELRLFHGRGGTVGRGGGPSYDAILAQPPGSVNGQIRITEQGEVISSKYSN
PEIGRRNLETLIAATIEATLLDHPHNADGDPEYMRIMEALSLDAFAAYRKLVYETPGFTD
YFFTATPIREIAELNIGSRPSSRKASDRIEDLRAIPWVFSWGLNRVMLPGWFGFGSAVKQ
FIQREGDAGLKQLQAMYKNWAFFRGMMSNMDMVLSKSDMGIAWRYAELVQDIELRDRIFG
AINNEWEATIEMLFAVTGATTLLQDNPAFARSLLTRTPYIDPLNHLQVALLHRHRAGDND
EKVKRAIHLTINGIATGLRNSG
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgatctctgcaccagccgacatttccagtaaagacattccgctgcgcgacgat
gtgcgcctgttgggccgcatccttggcgataccttgcgcgaacaggaaggcgaggaaacc
tacaagttgatcgagagcgtgcgcagggctgccgttcgttttcgcaagacccaggatgag
caggatggcgaattgctcgagcagatgttggatcaattgtcccctaccgagacgctggtc
gtcgtccgcgcattcagctatttctcgcaactgaccaatatcgccgaagacctgcatcac
aaccgccgccaccgcgcccatctcaaggcgggaagcccgcccaaggacggcacgctgcaa
cttgcactggatcgactcgaagagaaaaagatcgacaaggatactttgcaatccttcctg
aacagcgcactggtctcgccggttctgaccgcacatccgactgaagtgcagcgcaagagc
atacttgattgtcacctcatcatatccagcctgcttgccaatcgcgatcgcgtcgatatg
acaccagacgaccttgccgagaacgaggaggcgttgcaccgttttgtgttgatcctgtgg
cagacgcgcatgatgcgcactgccaagctgaacgtgcgcgacgagatacgcaatggcctg
gagtactaccactacaccttcctagccgagatccccaaactgtacgccaacctggagaag
cagctggaatcgcgctttgacaaggatatcaaggtgccgccgctgcttcgcgtcggcagc
tggataggcggcgatcgtgacggcaatccttttgtcacccacgatgtgatgaccgatgcc
gtgcgcgaacactccatactcgcgcttgagtactatctgaacgagacccatctgctcggc
acacgtttgagcctgaccgaccggctggtcgaggtcacacccgaattgcgcaaactgtcc
gatgcttcgccggacaatgtatttgtccggctcgatgagccctatcgccgcgcattgatt
ctgatctattcgcgcctgactgccaccgccaagcatcttggccacgacacttcccatctg
cgcccggtcgatgcgcatgcgcaaccttatgcgaccgcgcaggatttcattgccgacctg
gatgtgatgatcgactcgctgttcaagcacggcgcggtctatctcgctcggggaagactt
gccaacctgcgccgtgccgtggaagtcttcggcttctaccttgcgccgctggatatgcgc
cagcacagtgcgatcctggaacaaaccgtcagcgagctgttctcgcatagctccggcaaa
gccaattacagcgacctggatgaagcgggcaagcgctcggtgctactggaggcattgcag
tccggcaagatccttctggccgatatcaaacgctattccgatgtcccgcaaagcgaattg
cgcatcatgcaggctgcagccgagatccatcgccgtttcggccatggcgccctgcccaac
cacatcatctccaagaccgatgccgtgagcgacatgcttgaagtcgcactgatgctgcaa
cagtttggcttgttgcaggatggcgatacgcttcacgtcaatatcatcccgttgttcgaa
accattgaagacctgcgtggtggtgcctccatcatggatgaattgttttccattccctgg
tatcgcaagttgctgtccagccgcggcaacacccaggaagtgatgctgggctattccgac
agcaacaaggacggcggctatttgactgccaactgggagctgtacaaggccgaggtcgaa
ctggtcaaagtattcgcgaagcacggcatcgaactgcgcttgttccatgggcgcggcggc
accgtgggccgtggcggcggccccagctatgacgccattctggcgcagcctcccggaagc
gtgaacgggcagatccgcatcaccgaacagggcgaagtcatctccagcaaatactccaac
ccggagatcggacgccgcaatctggaaacgctgatcgccgccacgatagaagccacgctg
ctcgatcatccccataatgccgacggcgatccggaatacatgcgcatcatggaagcgctg
agtctcgatgcgttcgcggcttatcgcaaactcgtgtacgaaacaccgggtttcaccgat
tattttttcacggccacgcccatccgcgagatcgccgaactcaacatcggcagccgtcca
tcatcacgcaaggcttccgaccgcatcgaagatctgcgtgccatcccctgggtgttcagc
tggggcctgaatcgcgtgatgctgccgggctggttcggtttcggcagcgccgtgaagcaa
ttcatccagcgcgaaggcgatgccggactcaagcaattgcaagccatgtacaagaattgg
gcgttcttccgcggcatgatgtccaatatggacatggtgctttccaagagcgacatgggt
atcgcctggcgctatgccgaactggttcaggacattgaattgcgcgaccgtattttcggt
gcgatcaataacgaatgggaagccaccatcgagatgctttttgcagtgaccggcgccacg
acgctgctgcaggacaatcctgcctttgctcgcagcctgctgacccgtactccctacatc
gatccgctcaatcacttgcaggtcgcgctgttgcatcgccatcgcgccggggataacgac
gagaaggtaaagcgtgcgattcacctcaccatcaatggtatcgccaccgggttgcgtaac
agcggttga

DBGET integrated database retrieval system