KEGG   Sideroxydans lithotrophicus: Slit_0985Help
Entry
Slit_0985         CDS       T01196                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
slt  Sideroxydans lithotrophicus
Pathway
slt00630  Glyoxylate and dicarboxylate metabolism
slt00710  Carbon fixation in photosynthetic organisms
slt01100  Metabolic pathways
slt01120  Microbial metabolism in diverse environments
slt01200  Carbon metabolism
Module
slt_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:slt00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Slit_0985
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Slit_0985
Enzymes [BR:slt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Slit_0985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ADE11223
UniProt: D5CQ59
LinkDB All DBs
Position
969028..970449
Genome map
AA seq 473 aa AA seqDB search
MAVKTYNAGVKEYRQTYWTPEYTPLDTDILACFKITPQPGVDREEVAAAVAAESSTGTWT
TVWTDLLTDLDYYKGRAYRIEDVPGDDTCFYAFVAYPIDLFEEGSVVNVLTSLVGNVFGF
KALRALRLEDVRFPIAYVKTCGGPPQGIQVERDKMNKYGRPLLGCTIKPKLGLSAKNYGR
AVYECLRGGLDFTKDDENVNSQPFMRWRDRFEFVHEATLKAERETGERKGHYLNVTAPTP
EEMYKRAEFAKEIGAPIIMHDYLTGGLTANTGLANWCRNNGMLLHIHRAMHAVLDRNPHH
GIHFRVLTKVLRLSGGDHLHSGTVVGKLEGDREATLGWIDTMRDEFIKEDRSRGLFFDQD
WGSMPGVLPVASGGIHVWHMPALVTIFGDDSVLQFGGGTLGHPWGNAAGAAANRVALEAC
VAARNQGVAVEKEGKSILTEAAKSSPELKIAMETWKEIKFEFDTVDKLDVAHK
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcaagacatataacgccggtgtaaaagaataccggcaaacctactggacgccg
gaatacaccccgctggataccgacatcctcgcctgtttcaagatcacccctcagcctggc
gtggaccgtgaagaagttgcggccgcagtcgccgcagagtcctcaaccggcacctggacc
acggtatggaccgatctgctgaccgatctggattactacaaggggcgtgcctatcgcatc
gaagacgtgcccggagatgatacctgcttctatgcgtttgttgcttacccgatcgacttg
ttcgaagagggctctgtcgtcaacgtgctgacctcgctggtcggcaacgtgttcggcttc
aaggcgttgcgcgccctgcgtctggaagacgtgcgcttcccgatcgcctatgtgaagact
tgcggcggacctcctcagggcatccaggtcgagcgcgacaagatgaacaagtatggccgc
ccgctgctgggctgcaccatcaagcccaaattgggtctctccgccaagaactacggccgt
gccgtgtacgagtgcctgcgcggtggcctggatttcaccaaggacgacgagaacgtcaat
agccagccgttcatgcgctggcgcgaccgtttcgaattcgtgcacgaagccacgctgaaa
gccgagcgcgagaccggcgagcgcaagggccactacctgaacgtgaccgcgccgacgccg
gaagagatgtacaagcgcgccgagtttgccaaggagatcggcgcaccgatcatcatgcac
gactacctgaccggcggcctgaccgccaacaccggcctggccaactggtgccgcaataac
ggcatgctgctgcacattcaccgcgccatgcacgccgtactggaccgcaatccgcaccac
ggcatccacttccgcgtgctgaccaaggtgctgcgcctgtccggcggcgaccacctgcac
tcgggcaccgtggtcggcaagctggaaggcgaccgcgaggcgacgctgggctggatcgac
accatgcgcgacgagttcatcaaggaagaccgcagtcgcggcctcttcttcgatcaggac
tggggctccatgcccggcgtcttgccggtcgcctccggcggtatccacgtatggcacatg
ccggcgctggtgaccatcttcggcgacgactccgtgttgcagttcggcggcggcacgctg
ggtcacccgtggggcaatgcggccggtgcggcagccaaccgcgttgcgctcgaggcctgt
gtggcagcgcgcaaccagggcgtagcagtcgagaaggaaggcaagtccatcctgaccgaa
gccgcgaaatccagcccggaactgaagatcgccatggaaacgtggaaagagatcaagttc
gagttcgacaccgtcgacaagctggacgtggcacacaagtaa

DBGET integrated database retrieval system