KEGG   Sideroxydans lithotrophicus: Slit_1838Help
Entry
Slit_1838         CDS       T01196                                 

Definition
(GenBank) succinate dehydrogenase and fumarate reductase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
slt  Sideroxydans lithotrophicus
Pathway
slt00020  Citrate cycle (TCA cycle)
slt00190  Oxidative phosphorylation
slt00650  Butanoate metabolism
slt01100  Metabolic pathways
slt01110  Biosynthesis of secondary metabolites
slt01120  Microbial metabolism in diverse environments
slt01130  Biosynthesis of antibiotics
slt01200  Carbon metabolism
Module
slt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
slt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
slt_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:slt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Slit_1838
   00650 Butanoate metabolism
    Slit_1838
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Slit_1838
Enzymes [BR:slt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Slit_1838
    1.3.5.4  fumarate reductase (quinol)
     Slit_1838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_7 Fer4_4 Fer4_9 Fer4_18 Fer4 Fer4_16
Motif
Other DBs
NCBI-ProteinID: ADE12067
UniProt: D5CSY1
LinkDB All DBs
Position
complement(1868050..1868745)
Genome map
AA seq 231 aa AA seqDB search
MKFRIYRYNPDTDNSPYMQDYDLGMDAGDAMLLDALMQLKEQDDTLSFRKSCREGVCGSD
AMNINGRNGLACITSLSSLKQPIEIRPLPGLPVIRDLIVDMSQFFKQYHSIKPYLVNNDP
PPETERLQSPKDRLELDGLYECILCGCCTTACPSFWWNPDKFVGPAGLLQAYRFIADTRD
QDTAARLDNLEDPYRLFRCHTIMNCVDVCPKELNPTEAIGKIKDMMVKRAV
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaaattccgtatctaccgctacaatcccgacactgacaactcgccttacatgcaggac
tacgacctgggcatggatgcgggcgatgccatgctgcttgatgcgctgatgcaattgaag
gagcaggatgatacgctcagcttccgcaagtcctgccgcgagggtgtgtgcgggtcggat
gcgatgaacatcaacgggcgcaacggtttggcctgcatcacgtcgctgtcctcgctcaag
caaccgatcgagatccgtccgttgcccgggctgccggtcatccgcgacctgatcgtggac
atgtcccagttcttcaagcagtatcattcgatcaaaccgtatctggtgaacaacgatccg
ccgccggagacggagcgcctgcaatcgccgaaggaccggctggagctggacggtctgtat
gaatgcatcctgtgcggttgctgcacgacggcctgtccgtcgttctggtggaatccggac
aaattcgttggcccggccgggctgttgcaggcttaccggttcatcgccgatacgcgggat
caggacaccgcggcgcgtctggataacctggaagacccgtatcgcctgttccgctgccat
accatcatgaactgtgtggatgtatgcccgaaagaactgaacccgacggaagcgatcggc
aagatcaaggatatgatggtgaaacgggccgtatga

DBGET integrated database retrieval system