KEGG   Sideroxydans lithotrophicus: Slit_1839Help
Entry
Slit_1839         CDS       T01196                                 

Definition
(GenBank) succinate dehydrogenase or fumarate reductase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
slt  Sideroxydans lithotrophicus
Pathway
slt00020  Citrate cycle (TCA cycle)
slt00190  Oxidative phosphorylation
slt00650  Butanoate metabolism
slt01100  Metabolic pathways
slt01110  Biosynthesis of secondary metabolites
slt01120  Microbial metabolism in diverse environments
slt01130  Biosynthesis of antibiotics
slt01200  Carbon metabolism
Module
slt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
slt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
slt_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:slt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Slit_1839
   00650 Butanoate metabolism
    Slit_1839
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Slit_1839
Enzymes [BR:slt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Slit_1839
    1.3.5.4  fumarate reductase (quinol)
     Slit_1839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 DAO FAD_binding_3 GIDA HI0933_like NAD_binding_7 Lycopene_cycl Pyr_redox_3 FAD_oxidored NAD_binding_8 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ADE12068
UniProt: D5CSY2
LinkDB All DBs
Position
complement(1868756..1870519)
Genome map
AA seq 587 aa AA seqDB search
MALAKRTFDVVVVGAGGAGMRAALTLSHAGLKVAVLSKVFPTRSHTVAAQGGIAASLGNV
NEDNWHWHMYDTVKGSDYLGDQDAIEYMCRAAPEVVYELEHFGMPFDRLDSGKIYQRPFG
GHMQEYGKNPVPRACAAADRTGHALLHTLYQQNVKANTNFFVEWMALDLIRDQDGDVLGV
VAMEIETSEVMILQARATLFATGGAGRIFSASTNAYINTGDGLGMAARAGIPLEDMEFFQ
FHPTGVHGSGVLITEGVRGEGGYLVNKDGERFMPRYAPTAKDLASRDVVSRAMATEIKEG
RGCGPHGDHVMLKLDHLGDEVIRHRLPGIRDIALKFAHVDPAKAPIPVVPTAHYMMGGIP
TNYHGQVVAPHGTAPEDVVQGFYAVGECACVSVHGANRLGCNSLLDLIVFGRSAARQIIE
DLKNNPNPKPLPADAADRPLARLARLENQKDGERVAEVGDAMRRTMQTHCGVFRFPDLLT
EGVANIREVAERVRHTEIKDKSKVFNTARVEALELDNLIEVAQATMTAAEARKESRGAHA
REDYPERDDKSWLKHSLYYSEGHRLDYKPVRLKPLTVESFPLKARVY
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atggcattggcgaaaagaacattcgatgtggttgtggtgggtgcgggtggggcggggatg
cgcgctgcgctgacgttgtcgcatgcgggactcaaggttgcggtgctgtccaaggtgttc
ccgacacgttcgcataccgtggctgctcaaggcggcatcgccgcctcgctgggtaacgtc
aacgaagacaactggcactggcatatgtacgacacggtgaaaggttcggattacctgggt
gaccaggatgccatcgagtacatgtgccgtgccgcgccggaagtggtatatgaactggaa
cacttcggcatgccgttcgaccggctggacagcggcaagatataccagcggcctttcggc
ggacacatgcaggaatacggcaagaacccggtgccgcgtgcctgtgcggcagccgaccgc
accggtcacgcgctgctgcacactttgtaccagcagaatgtgaaagccaacacgaatttc
ttcgtcgaatggatggcgctcgacctgatccgcgaccaggacggcgacgtactgggcgtg
gtggcgatggagatcgagacttccgaagtgatgatcctgcaggcgcgtgccacattgttt
gcgaccgggggcgcggggcgcatattctctgcgagcaccaatgcctatatcaatacgggt
gacggcctcggcatggccgcgcgtgccggcattccgctggaagacatggagttcttccag
ttccacccgaccggggtgcatggctcgggcgtgttgatcaccgaaggcgtgcgcggcgaa
gggggctacctggtgaacaaggatggcgaacgcttcatgccgcgttacgcgccaaccgcc
aaggatctggccagccgcgatgtggtgtcgcgcgcgatggcgaccgagatcaaggaaggg
cgcggttgtggaccgcacggcgatcatgtcatgctcaaactggatcatctgggcgatgag
gtgatccgtcaccgtctgccgggcatacgtgacatcgcgctcaagtttgcgcatgtcgat
cccgccaaggcgcccatcccggtggtgccgaccgcgcattacatgatgggtggcatcccg
accaactatcacgggcaggtcgttgctccgcacgggactgcgccggaagatgtggtacag
ggtttttatgccgtcggcgaatgcgcttgtgtatcggtgcacggtgcaaatcggctgggc
tgcaactcgctgctcgacctgatcgtgttcgggcgttcggctgcgcgccagatcatcgag
gacttgaagaacaatcccaaccccaaaccgttgcccgccgatgcggcagatcgtccattg
gcccgtctggcccgtctggagaaccagaaagatggcgagcgggtcgcggaagtaggcgat
gcaatgcgccggaccatgcagacgcattgcggcgtgttccgtttccccgatctgttgacc
gaaggcgtggccaatatccgcgaagtggcggaacgggtgcgtcataccgagatcaaagac
aagagcaaagtgttcaacactgcgcgtgtcgaggcgctggaactggataatctgatcgaa
gtggctcaggcaacgatgactgccgcagaggctcgcaaagagagccgtggcgcgcatgcg
cgcgaagattatcctgagcgggatgacaagagctggctgaaacattccctgtactacagc
gaaggccatcggctcgattacaaaccggtgcggttgaaacccctgacggtggagtcgttc
ccgctcaaggctcgagtgtattga

DBGET integrated database retrieval system