KEGG   Streptococcus lutetiensis: KE3_0480Help
Entry
KE3_0480          CDS       T02775                                 

Definition
(GenBank) serine/threonine protein kinase PrkC
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
slu  Streptococcus lutetiensis
Brite
KEGG Orthology (KO) [BR:slu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:slu01001]
    KE3_0480
Enzymes [BR:slu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     KE3_0480
Protein kinases [BR:slu01001]
 Serine/threonine kinases: Other
  Bacterial family
   KE3_0480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Kdo RIO1 APH Kinase-like Plasmod_dom_1 FTA2 Haspin_kinase ATP-synt_I Fructosamin_kin Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: AGS05007
UniProt: S5QW05
LinkDB All DBs
Position
438227..440137
Genome map
AA seq 636 aa AA seqDB search
MIQIGKLFAGRYRILKSIGRGGMADVYLAKDLILDNEEVAIKVLRTNYQTDQIAVARFQR
EARAMAELNHPNIVSIRDIGEEDGQQFLVMEYVDGSDLKKYIQDHAPLSNNEVVRIMEEV
LSAMTLAHQQGIVHRDLKPQNILLTKDGTVKVTDFGIAVAFAETSLTQTNSMLGSVHYLS
PEQARGSKATVQSDIYAMGIMLFEMLTGHIPYDGDSAVTIALQHFQKPLPSIIDENKNVP
QALENVVIKATAKRLSDRYASTFEMSRDLMTALSYNRSRERKLVFEDTENTKTLPKVTTS
TPVPSTTEQLLTKQKAAKVNREAVDNKIAKAKTKKKKSHRMFGTLVKIFFAVVVVAIAIF
TYLTLSTPASVNVPDVAGTSLQAAKTSLTSAGLKVGRTKGIYSDTVPSGQVIETNPKAGT
SKKEGAKVDIYVSKGTSGFKMKDYTGQNYQEVIKELKDKHGISSDKIDVEWITGTNYDGG
TIISQTPEKGTKVASEDKITFKVAAIVMPNLIGYTYQDAIAELTALGLSSSHIIVFQADA
TSSTGYSQVKTPSASAVVVAQDPYFGASIEGEVNLYFSARSEAQSSEVAPSQSVSESYET
SETSESSSLSSSSSSSSSSSSSSTEESSQTDSSSVE
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgattcagattggcaaattatttgctggtcgttatcggatcctcaagtctatcggacgg
ggtggaatggcagatgtttatcttgccaaagatctaattcttgataatgaagaagtggct
atcaaagtccttcgaactaattatcaaacagatcaaattgccgttgctcgtttccaacgt
gaagcacgtgccatggcagagctaaaccatccaaatatcgtttcgattcgtgatattgga
gaagaagacggacagcaattcttagtaatggaatatgttgatggctcggacttgaaaaaa
tatattcaagaccacgcccctctttctaataatgaagttgttagaatcatggaagaagtc
ttgtctgcgatgactttggctcatcaacaaggaattgttcaccgtgatttgaaaccacaa
aatatcttgttaaccaaagacggaacggttaaagttaccgactttggtatcgctgtagct
tttgcagaaacaagtttaacacaaacaaactcaatgcttggtagtgtacactatttatca
cctgaacaagcgcgtggttcaaaagccactgttcaaagtgatatctacgctatggggatt
atgttgtttgaaatgttgactggtcacattccatatgatggtgattcagctgttacgatt
gctcttcaacatttccaaaaaccacttccatcaatcattgatgaaaataaaaatgttcca
caagctttggaaaatgttgtcattaaagcaactgcaaaacgtttgagtgatcgctacgcc
tcaacttttgaaatgagtcgtgatttaatgactgctctctcatataaccgtagccgcgaa
cgcaaacttgtctttgaagatacagaaaatacgaagacacttccaaaagtaacaacttca
acacctgttccctcaacaacagaacaattgttgacaaaacaaaaagcagctaaagttaat
cgtgaagctgtggataataaaattgcaaaagcgaaaacgaagaagaaaaaatcacatcgt
atgtttggtactttagtgaaaattttctttgcggtcgtagtagttgcaattgctatcttt
acttacttgacgctaagcacaccagcttcagtcaacgttccagatgtagctggaacaagt
ttacaagctgctaagacaagtcttacatcagcaggacttaaagttggaaggaccaaggga
atttatagtgatactgttccaagtggtcaggttattgagactaatccgaaagctggcaca
tctaagaaagaaggtgccaaagttgacatttatgtgtcaaaaggaacatcaggctttaag
atgaaagattatactggtcaaaactatcaagaagttatcaaagaactcaaagataaacac
ggtatttcaagtgataagattgatgttgaatggataacaggcactaactatgatggtggt
actatcattagtcaaacacctgaaaaaggtacaaaagttgctagtgaagataagattact
ttcaaggttgcagcaatcgttatgccaaaccttattggttatacttatcaagatgcaatt
gctgaattgactgcacttggcttatcaagttcgcatattatagtattccaagcagatgct
acttcatcaactggatattctcaagttaaaacaccatctgcctctgcagttgttgtggca
caagatccttactttggcgcatctattgaaggagaggttaacctttacttctcagctaga
agtgaagctcagtcttcagaagttgcaccatctcaatctgtttctgagtcatatgagaca
agtgaaactagtgagtcaagttctttaagcagcagcagtagcagtagtagcagtagtagc
agtagcagcactgaagaaagttcacaaaccgactcatcatcagttgaataa

DBGET integrated database retrieval system