KEGG   Streptococcus lutetiensis: KE3_0621Help
Entry
KE3_0621          CDS       T02775                                 

Definition
(GenBank) superoxide dismutase (Mn)
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
slu  Streptococcus lutetiensis
Brite
Enzymes [BR:slu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     KE3_0621
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AGS05129
UniProt: S5QZ96
LinkDB All DBs
Position
568624..569235
Genome map
AA seq 203 aa AA seqDB search
MAIILPELPYAYDALEPYIDAETMTLHHDKHHATYVANANAALEKHPELGDDLEVILADL
DKIPADIRQAVINNGGGALNHSLFWEFLSPEKQEPTADVLAAIEEAFGSFDEFKAVFTKA
ATTRFGSGWAWLVVNKDDKLEVISTANQDNPISEGKKPILGLDVWEHAYYLKYHNVRPDY
IKAFFDIINWAKVAELYKAAIAD
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggctattattttacccgaattaccatacgcatacgatgcgcttgaaccatacatcgat
gcagaaacaatgacattgcaccatgataaacatcatgccacttatgtagcaaatgccaat
gcggctcttgaaaaacaccctgaacttggagatgatttagaagttatcttggcagatctt
gacaagattccagcagatattcgtcaagcggtgattaacaatggtggtggtgctcttaac
cactcacttttctgggaattcctttctcctgaaaaacaagagccgacagcagatgttttg
gctgcgattgaagaagcttttggttcatttgatgagtttaaagctgtctttacaaaagct
gcaacaacacgtttcggttcaggttgggcatggcttgtcgttaacaaagatgacaaactc
gaagtaatctcaacagctaaccaagacaatccaatttcagaaggtaaaaaaccaattctt
ggtcttgatgtttgggaacatgcctactatctcaaataccataatgttcgaccagactat
atcaaagctttctttgatattatcaattgggcaaaagttgctgaattgtacaaagcagca
attgctgactaa

DBGET integrated database retrieval system