KEGG   Streptococcus lutetiensis: KE3_0912Help
Entry
KE3_0912          CDS       T02775                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
slu  Streptococcus lutetiensis
Pathway
slu00010  Glycolysis / Gluconeogenesis
slu00020  Citrate cycle (TCA cycle)
slu00620  Pyruvate metabolism
slu01100  Metabolic pathways
slu01110  Biosynthesis of secondary metabolites
slu01120  Microbial metabolism in diverse environments
slu01130  Biosynthesis of antibiotics
slu01200  Carbon metabolism
Module
slu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:slu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KE3_0912
   00020 Citrate cycle (TCA cycle)
    KE3_0912
   00620 Pyruvate metabolism
    KE3_0912
Enzymes [BR:slu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     KE3_0912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 HlyD_3
Motif
Other DBs
NCBI-ProteinID: AGS05407
UniProt: S5QX03
LinkDB All DBs
Position
872672..874015
Genome map
AA seq 447 aa AA seqDB search
MANEIIMPKLGVDMQEGEILEWKFSEGDVVNEGDILLEIMSDKTNMEIEADDSGVLLKII
HPAGDVVPVTEVIGYIGAAGENVDDLVREEQAEQLESVQEASADFSQPSDALAIFQKSKI
RATPAARKLAAERGIALDSISGTGENGRIHKDDVVRFAKLRVTPLARRIAEDMGLELSGI
AGTGISGKITKDDVFAKAGTDKNKGSEEIQSVPDGIEVIKMSAMRKAISKGMSKSYFTAP
TFTLNYDIDMTNLLALRKQLVEPIMAKTGYKVTVTDLIGLAVAKILIKEEHRYLNASLIN
DAKAIELHHFVNLGIAVGLPDGLVVPVVHGADKMTLSDFVVASKDVIQKAQAGKLKAADM
SGSTFSITNLGMFGVKSFNPIINQPNSAILGISATVDTPVAIDGQVVIRPIMGLSLTIDH
RLVDGMNGAKFMLDLKALLENPLELLI
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaatgagattatcatgccaaaacttggtgtagacatgcaagaaggagaaattctc
gagtggaaattctctgaaggcgatgtagtgaacgaaggtgacattcttcttgaaatcatg
tccgacaagactaatatggaaatcgaagctgacgactctggtgtacttttgaaaatcata
cacccagctggtgatgtagtgccagtgactgaggtgattggctatatcggagcagcaggg
gaaaacgttgatgatttggtgagagaagaacaggcggaacagttagaatcagttcaggaa
gcgtcagctgatttctctcaaccgtctgatgcgctagccattttccaaaaaagtaagata
cgtgcgacaccagcagctagaaagctagccgcagagcgtggaatcgcgcttgatagcatc
agcgggactggtgaaaatgggcgtattcataaagatgacgtggtgaggtttgctaagctg
cgcgtgacgccgcttgctcgtaggattgcggaagatatgggccttgagctttctggtatc
gctggaactggtattagtggcaagattactaaggatgatgtctttgctaaagcaggtacc
gataagaataagggtagtgaagagattcaaagtgtgccagatggtatcgaagtgattaaa
atgtctgctatgcgcaaggcaatctcaaaaggcatgtcgaagtcttactttacagctcca
actttcacgcttaattatgacattgatatgacgaatcttttggcgcttcgaaagcagttg
gttgagccaatcatggcaaaaacgggttacaaggtgactgtaactgatttgattggactt
gcggttgcgaagatcttgataaaagaggagcatcgttatttaaatgcctctttgattaat
gacgcaaaagctattgagttgcatcattttgttaatctgggtattgccgtgggcttgcca
gatggtttggtggttccagttgttcatggagctgataagatgaccttgtctgattttgtg
gttgcctcaaaagatgtgattcagaaagcgcaagctggcaaattaaaggcagctgatatg
tctgggtcaactttctctatcacgaacctaggaatgtttggggttaagtcctttaacccg
attatcaaccagccaaactctgctattttaggaatttcagcgaccgttgacacgccagtt
gctattgatggacaggtagtgattcgtccaattatgggacttagcttgaccattgatcat
cgtttggtcgacgggatgaatggtgctaaatttatgttggatttaaaagcgttgctagaa
aatcctttggaactattgatttga

DBGET integrated database retrieval system