KEGG   Streptococcus lutetiensis: KE3_1730Help
Entry
KE3_1730          CDS       T02775                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
slu  Streptococcus lutetiensis
Pathway
slu00220  Arginine biosynthesis
slu00250  Alanine, aspartate and glutamate metabolism
slu00290  Valine, leucine and isoleucine biosynthesis
slu01100  Metabolic pathways
slu01110  Biosynthesis of secondary metabolites
slu01130  Biosynthesis of antibiotics
slu01210  2-Oxocarboxylic acid metabolism
slu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:slu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KE3_1730
   00290 Valine, leucine and isoleucine biosynthesis
    KE3_1730
   00220 Arginine biosynthesis
    KE3_1730
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:slu01007]
    KE3_1730
Enzymes [BR:slu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     KE3_1730
    2.6.1.66  valine---pyruvate transaminase
     KE3_1730
Amino acid related enzymes [BR:slu01007]
 Aminotransferase (transaminase)
  Class I
   KE3_1730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Beta_elim_lyase Cys_Met_Meta_PP Aminotran_3 MHC_II_alpha
Motif
Other DBs
NCBI-ProteinID: AGS06191
UniProt: S5RJX9
LinkDB All DBs
Position
complement(1662355..1663569)
Genome map
AA seq 404 aa AA seqDB search
MKIFDKSSKLEHVAYDIRGPILDEANRMIANGEKILRLNTGNPAAFGFQAPDEVIRDLIA
HARNSEGYSDSKGIFSARKAIMQYCQLKGFPHVDIDDIYLGNGVSELISISLQALLDDGD
EVLVPMPDYPLWTACVSLAGGNAVHYLCDEQANWYPDIDDIKSKITSNTKAIVIINPNNP
TGALYPDDLLKEIVEIARQNDLIIFADEIYDRLVMDGKKHTAIASLAPDVFCVSMNGLSK
SHRICGFRVGWMVLSGPKQNVKGYIEGLNMLANMRLCANVLGQNVVQTSLGGYQSVDELL
IPGGRIYEQRNFIYKAVNEVPGLSAVKPEAGLYIFPKIDRNMYQIDDDEQFCLELLKQEK
VMLVPGKGFNWNEPDHFRIVYLPRVEELAEVQEKLTRVLSQYKR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatatttgataaatcttcaaagctagaacatgttgcatacgatattcgtgggcca
attcttgatgaagccaatcgtatgattgctaacggtgagaaaattcttcgccttaatacc
ggaaacccagctgcctttggttttcaagcgccagatgaggttatccgtgacttgattgct
cacgctcgtaatagtgaagggtattctgatagtaaagggattttttctgctcgtaaagct
atcatgcaatactgtcagttaaaaggatttccacatgtggatatcgatgatatttatcta
ggaaatggtgtctctgagcttatctcaatatcacttcaagcccttcttgatgatggtgat
gaagtcttggtgccaatgcctgattacccattgtggacagcttgtgtcagccttgctggg
ggaaatgccgtgcattacctttgtgatgaacaagctaattggtatcctgatattgatgac
atcaaatccaaaatcacatcaaataccaaagctattgttatcattaatccaaataaccca
acaggtgctttgtatcccgatgaccttttgaaagaaatcgtggaaattgctcgtcaaaat
gacttgatcatttttgcagatgaaatctatgaccgtttggttatggatggcaaaaaacat
actgccattgctagcttagcacctgatgttttctgtgtgtcaatgaatggtttatcaaaa
tcacaccgaatctgtggtttccgtgttggatggatggtcctatcaggtccaaaacaaaat
gttaaaggatacattgaagggcttaatatgttagctaatatgcgtctttgcgcaaacgtc
ttaggacaaaatgttgttcagacttctctaggtggttatcaatcagtcgatgaacttttg
attcctggtggtcgtatttatgaacaacgtaacttcatctataaggcagtaaatgaagtg
ccaggtttgtctgcagtgaaaccagaagcaggactttacattttccctaaaatcgaccgt
aatatgtatcaaattgatgacgatgaacagttctgtttagaactgctaaaacaagaaaaa
gtcatgttggttccaggtaaaggtttcaactggaatgaacctgaccacttccgaattgtc
tatttgccacgtgttgaagaattagctgaggttcaagagaagctaacacgcgttcttagt
cagtacaaacgttaa

DBGET integrated database retrieval system