KEGG   Streptomyces lividans: SLIV_02275Help
Entry
SLIV_02275        CDS       T03222                                 

Gene name
bbgII
Definition
(GenBank) Beta-galactosidase BbgII
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
slv  Streptomyces lividans
Pathway
slv00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:slv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SLIV_02275 (bbgII)
Enzymes [BR:slv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SLIV_02275 (bbgII)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_14 Cellulase DUF4350 DUF3459 Glyco_hydro_35
Motif
Other DBs
NCBI-ProteinID: AIJ11483
UniProt: D6EVT8
LinkDB All DBs
Position
476664..478709
Genome map
AA seq 681 aa AA seqDB search
MISTLHSRLHRGADGAPAPRLAYGADYNPEQWPREVWEEDVRLMREAGVNIVSLGIFSWA
RIQPGPDTWDFAWLDEVMDLLHEHGVGVDLATATASPPPWLTTAHPEILPVTDRGETLWP
GARQHWRPTSPVFREHALRLVRKLATRYADHPALVAWHVNNELGCHNVYDYSDDAARAFR
DWLRARYGTTDALNHAWGTAFWSQRYGDWAEVLPPRLAASHPNPTQQLDFKRFSSDALKD
HLRVERDLLRELTPDVPVTTNFMVMPGTKGMNYADWAGEVDFVANDHYVVPHPQARDELS
FSANLTSGIAGGRPWFLMEHSTSAVNWQPVNLAKRPGEMARDSLTHVAHGADAVCFFQWR
QSAAGAEKYHSAMVPHAGADSDLFRAVTALGDTLKTLAPVAGSEREPAEVGILFDWESRW
ASEQDSHPTSLLDYHQEALDWYSALLSLGVRADVVTTGADLSRHRVLIAPVLHLVPAELA
KDLTRYAEQGGHLVTTYFSGIVDENDHVWLGGYPGALRDLLGIRVEEFGPLPAGQSVELD
GAGSGDLWTDRITVTAPETEVLARYRTGTHAGHPAVTRRPAGRGSAAYVSTRLGADGLAA
LLPRLLEPAGVTSELPASVRGRVEATVRRGAGGRFLFLVNRTDEAVTVPGLTGDVLVGDT
GDEGAVVLAGRGVAVLRTPTP
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgatctccaccctccactcccgcctgcaccgcggggcggacggtgcgcccgccccgcgt
ctcgcctacggcgccgactacaaccccgagcagtggccccgggaggtgtgggaggaggac
gtacggctgatgcgggaggccggggtcaacatcgtgtcgctcggcatcttctcctgggcc
cgcatccagccgggcccggacacctgggacttcgcctggctcgacgaggtgatggacctg
ctgcacgagcacggggtcggcgtcgacctggcgacggccaccgcgtccccgccgccctgg
ctgaccaccgcgcacccggagatcctcccggtcaccgaccggggcgagacgctgtggccg
ggagcacgtcagcactggcgcccgacctcgcccgttttccgggagcacgccctgcgcctg
gtgcggaagctggccacccgctacgccgaccacccggcgctcgtcgcctggcacgtcaac
aacgagctgggctgccacaacgtctacgactactccgacgacgccgcccgcgccttccgg
gactggctgcgcgcgcggtacggcaccacggacgccctcaaccacgcctggggcacggcg
ttctggtcgcagcgctacggcgactgggcggaggtcctgccgccccggctcgccgcctcg
cacccgaacccgacccagcagctggacttcaagcgcttctcctcggacgcgctcaaggac
cacctgcgcgtggagcgggacctgctgcgggagctgacgccggacgtcccggtcaccacc
aacttcatggtgatgcccggcacgaagggcatgaactacgcggactgggccggcgaggtc
gacttcgtcgccaacgaccactacgtcgtcccgcacccccaggcccgcgacgagctgtcg
ttctcggcgaacctcaccagcggcatcgcgggcggccgcccgtggttcctgatggagcac
tccacgagcgccgtgaactggcagccggtcaacctggccaaacggccgggcgagatggcc
cgggactcgctgacgcacgtggcgcacggcgccgacgcggtgtgcttcttccagtggcgc
cagtcggcggccggcgccgagaagtaccactcggcgatggtcccgcacgccggtgcggac
agcgacctgttccgcgcggtgaccgcgctcggcgacaccctgaagacgctcgcgccggtc
gccgggagcgagcgggagcccgccgaggtcggcatcctcttcgactgggagtcccggtgg
gccagcgagcaggactcgcaccccacctcgctgctcgactaccaccaggaggcgctcgac
tggtactcggcgctgctctccctgggcgtgcgcgccgacgtcgtcaccaccggcgccgac
ctgagccgccaccgggtgctgatcgcgccggtgctgcacctggtcccggccgagctggcc
aaggacctcacgcgctacgccgagcagggcgggcacctggtcaccacgtacttctcgggc
atcgtggacgagaacgaccacgtctggctgggcggctatccgggcgcgctgcgagacctg
ctcggcatccgcgtcgaggagttcggtccgctgcccgccgggcagagcgtggagctggac
ggcgcgggcagcggagacctgtggaccgaccggatcaccgtgaccgcgccggagaccgag
gtcctggcgcgctaccgcaccggcacccatgcgggccaccccgccgtcacccggcgcccg
gcgggccgcggctcggccgcctacgtctccacccggctcggcgccgacgggctcgccgcc
ctgctgccgaggctgctggagccggccggggtgaccagcgagctgcccgcctcggtgcgg
ggccgggtcgaggccaccgtgcgccggggcgccgggggacggttcctgttcctggtcaac
cggaccgacgaggccgtgaccgtccccgggctcaccggagacgtcctggtgggcgacacc
ggtgacgagggcgccgtcgtcctggcgggccggggggtcgccgtcctgcgcacgcccacc
ccctag

DBGET integrated database retrieval system