KEGG   Streptomyces lividans: SLIV_02570Help
Entry
SLIV_02570        CDS       T03222                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
slv  Streptomyces lividans
Pathway
slv03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:slv00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    SLIV_02570
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:slv03400]
    SLIV_02570
Enzymes [BR:slv01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SLIV_02570
DNA repair and recombination proteins [BR:slv03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     SLIV_02570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_OB_2 RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AIJ11541
UniProt: D6EX39
LinkDB All DBs
Position
539027..540007
Genome map
AA seq 326 aa AA seqDB search
MELPPIPPMLATPGTLPPAGQDTRWAYETKQDGQRVVVYLPGDGSVLLRARSGQDITAAY
PELAPLATALGGTPAVLDGEVLALDEQGRADFQLLQSRMGLAHTPARAAHRAAKVPVHLV
LFDALHLAGRSLLRLPYTGRRERLTDLGLNGPSWSTPAALVGHGAQALRATREHGLEGLV
CKRLDSVYEPGVRSRAWIKIRNMRSEDVVVGGWLPGKGRLGGLPGAVLVGQRAAGRLRYV
GGVGTGWSAGERTELAALLAAAASDVCPFDPVPRVPGARWVVPRLVGEVRYSTRTREGML
RQPSWLRLRPDLAPEESAADLPDDLA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtggagctgccgccgatccctccgatgctcgccacccccggcaccctgccgcccgccggg
caggacacgcgctgggcctacgagaccaagcaggacggacagcgcgtggtggtctacctg
cccggcgacggaagcgtcctgctgcgtgcccgctccggccaggacatcaccgccgcctat
ccggaactggctccgctcgccaccgcgctcggcgggacccccgccgtactggacggggag
gtgctggccctggacgaacagggccgtgccgatttccagttgctccagtcccggatgggc
ctcgcgcacaccccggcccgggcggcgcaccgggcggcgaaggtccccgtccacctggtg
ctcttcgacgccctgcacctggcgggccgctccctgctgcgcctgccctacaccggccgc
cgtgagcggctcacggacctcgggctgaacgggccgtcgtggtcgaccccggccgcgctg
gtcgggcacggcgcacaggccctgcgggccacccgcgagcacggcctggaggggctggtg
tgcaagcggctggactcggtgtacgagcccggggtccgctcccgggcctggatcaagatc
cgcaacatgcgcagcgaggacgtcgtggtgggcggctggctgcccggcaaggggcggctc
ggcggtctcccgggcgccgtcctggtcggccagcgcgccgctggccggctgcgctacgtc
ggcggggtcggcaccggttggagcgcgggcgagcgcaccgagctggccgcgctgctggcg
gccgcggccagtgacgtctgccccttcgacccggtgccgcgggtgccgggggcgcgctgg
gtcgtgccccggctggtcggcgaggtccgctacagcacccgcacccgggagggcatgctg
cgccagccgtcctggctcaggctccgcccggacctggcacccgaggagtcggccgcggac
ctgccggacgacctggcgtga

DBGET integrated database retrieval system