KEGG   Streptomyces lividans: SLIV_04075Help
Entry
SLIV_04075        CDS       T03222                                 

Definition
(GenBank) aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
slv  Streptomyces lividans
Pathway
slv00250  Alanine, aspartate and glutamate metabolism
slv00410  beta-Alanine metabolism
slv00640  Propanoate metabolism
slv00650  Butanoate metabolism
slv01100  Metabolic pathways
slv01120  Microbial metabolism in diverse environments
Module
slv_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:slv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SLIV_04075
   00650 Butanoate metabolism
    SLIV_04075
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SLIV_04075
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SLIV_04075
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:slv01007]
    SLIV_04075
Enzymes [BR:slv01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SLIV_04075
Amino acid related enzymes [BR:slv01007]
 Aminotransferase (transaminase)
  Class III
   SLIV_04075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AIJ11838
UniProt: D6EDN2
LinkDB All DBs
Position
complement(876386..877654)
Genome map
AA seq 422 aa AA seqDB search
MTALSPHLRQATPVVAVRGEGVHIEGEDGRRYLDFTAGIGVTSTGHCHPRVVAAAQEQVA
TLVHGQYTTVMHPPLRRLVDKLGEVLPQSLDSLFFTNSGSEAVEAALRLARQATGRPNVL
VCHGGFHGRTVAAASMTTSGTRFRSGFSPLMSGVVVTPFPTAFRYGWDEETATRFALQEL
DYTLQTISSPADTAAVIVEPVLGEGGYVPANRAFVEGLRERADRHGFLLILDEVQTGVGR
TGRFWGHEHFGVAPDILVTAKGLASGFPLSAIAAPEELMRKAWAGSQGGTYGANAVACAA
ACATLDVVRDEKLVENAEAMGARLRHGLEAVASRNPAVGDVRGMGLMLASEFVTADGEPD
PETAARVQRAAVDEGLLLLLCGAWNQVVRMIPALVIDETAVDEGLRAWAAAVEAGTSGAA
GR
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcactgtcgccgcaccttcgccaggccacccccgtggtggcggtccggggcgag
ggggtccacatcgagggcgaggacggccgccgctatctggacttcaccgccggcatcggc
gtcaccagcaccggccactgccacccccgcgtcgtggccgccgcccaggagcaggtcgcc
accctggtccacgggcagtacaccaccgtcatgcacccgccgctgcggcgcctggtcgac
aagctcggcgaggtgctgccccaaagcctggacagcctcttcttcaccaattccggcagc
gaggcggtcgaggccgcgctgcgcctggcccgccaggccaccggacggcccaacgtgctg
gtctgccacggcggcttccacggccgtacggtggccgccgcctccatgaccacctccggc
acccgcttccggtccgggttctcaccgctgatgagcggcgtggtcgtcacccccttcccg
acggccttccgctacggctgggacgaggagaccgccacccgcttcgcgctccaggagctg
gactacaccctccagacgatctcctcgcccgccgacaccgccgccgtcatcgtggaaccg
gtcttgggcgagggcgggtacgtgcccgcgaaccgcgccttcgtcgagggcctgcgcgag
cgcgccgaccggcacggcttcctgctcatcctggacgaggtgcagaccggcgtgggccgc
accggccggttctggggccacgagcacttcggtgtcgcccccgacatcctggtcaccgcc
aagggcctcgccagcggcttcccgctctccgccatcgccgcccccgaggagctgatgcgc
aaggcctgggcgggctcgcagggcgggacgtacggcgccaacgcggtcgcgtgcgcggcg
gcctgcgccacgctggacgtcgtgcgcgacgagaagctcgtcgagaacgccgaggcgatg
ggcgcccggctgcgccacggcctggaggcggtggcgtcccggaacccggccgtcggcgac
gtacgcggcatgggactgatgctggccagcgagttcgtcaccgccgacggcgagccggac
ccggagaccgccgcccgggtgcagcgggccgccgtcgacgagggactgctcctgctgctg
tgcggggcgtggaaccaggtggtgcgcatgatcccggccctggtgatcgacgagacggcc
gtcgacgagggcctgagggcgtgggccgccgccgtcgaggccggtacgtcgggagcggcg
ggacgatga

DBGET integrated database retrieval system