KEGG   Streptomyces lividans: SLIV_04145Help
Entry
SLIV_04145        CDS       T03222                                 

Gene name
aml
Definition
(GenBank) Alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
slv  Streptomyces lividans
Pathway
slv00500  Starch and sucrose metabolism
slv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SLIV_04145 (aml)
Enzymes [BR:slv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SLIV_04145 (aml)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_20 Alpha-amylase Alpha-amylase_C DUF4859
Motif
Other DBs
NCBI-ProteinID: AIJ11852
UniProt: D6EDP6
LinkDB All DBs
Position
complement(892712..894433)
Genome map
AA seq 573 aa AA seqDB search
MHGNTSPARRITATALALTAGVAGSLLATTAPAQASPPGDKDVTAVMFEWKFTSVAQACT
DTLGPAGYGYVQVSPPQEHIQGGQWWTSYQPVSYRIAGRLGDRAQFKSMVDTCHAAGVKV
VADSVVNHMSAGNGTGTGGSSYTKYDYPGLYSSNDLDNCTSQINNYGDRFNVQECELVGL
ADLDTGEDYVRGKIAGYLNDLLSLGVDGFRIDAAKHMAAADLAAIKSRLSNPNVYWKHEA
IYGAGEAVSPTEYVGSGDVQEFRYARDLKRVFNGENLAYLKNFGEAWGHLPSDEAAVFVT
NHDTERNGETLTYKDGATYTLAHVFMLAWPYGSPDVHSGYEFTDHDAGPPNGGQVNACYS
DGWKCQHAWREISSMVAFRNTARGQGVTDWWDNGGDQIAFGRGSKAYVAINHEGTSLTRT
FQTSLPAGDYCDVQTGKGVTVDGAGRFTATLGAGTAVALHVGARTCDGGDPGDPDPVSSG
VSFAVDATTSWGQNIYVTGNRPELGNWNPGGALQLDPAAYPVWKRDVELPEGTTFEYKYL
RKDDAGNVTWESGANRTATVNTTKTTLNDTWRN
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgcacgggaacaccagcccagcgcgaagaatcaccgccaccgcgctcgccctcaccgcc
ggcgtggccggcagcctcctcgccaccacggcaccggcccaggcgtccccacccggagac
aaggacgtcaccgcggtgatgttcgagtggaagttcacctccgtcgcccaggcctgcacc
gacaccctcggcccggccggctacggctacgtccaggtctcaccgccccaggagcacatc
cagggcggacagtggtggacctcgtaccagccggtgagctaccggatcgcgggccgcctc
ggtgaccgcgcccagttcaagagcatggtcgacacctgccacgccgccggggtgaaggtc
gtggccgactcggtcgtcaaccacatgtcggccggcaacggcacgggcaccggcggctcg
tcctacaccaagtacgactatcccggcctctactcgtcgaacgacctcgacaactgcacc
tcgcagataaacaactacggcgaccgcttcaacgtccaggagtgcgaactggtcggcctc
gcggacctggacaccggcgaggactacgtacgggggaagatcgccggctacctcaacgac
ctgctctccctcggcgtcgacggcttccgcatcgacgcggccaagcacatggccgccgcc
gacctggccgccatcaagtccaggctcagcaacccgaacgtctactggaagcacgaggcg
atctacggcgcgggcgaggccgtgtccccgaccgagtacgtcggcagcggcgacgtacag
gagttccgctacgcacgcgacctcaagcgcgtcttcaacggcgagaacctcgcgtacctg
aagaacttcggcgaggcctggggccacctgccctcggacgaggccgccgtcttcgtcacc
aaccacgacaccgagcgcaacggcgagaccctcacctacaaggacggcgccacctacacc
ctggcgcacgtcttcatgctggcctggccgtacggcagccccgacgtccactccggctac
gagttcaccgaccacgacgccgggccgccgaacggcggtcaggtgaacgcctgctacagc
gacggatggaagtgccagcacgcctggcgcgagatctcctccatggtcgctttccgcaac
accgcacgcggccagggggtgaccgactggtgggacaacggcggcgaccagatcgccttc
ggccgcggctccaaggcgtacgtcgccatcaaccacgagggcacctcgctgacccgtacg
ttccagacgtcgctgcccgcgggggactactgcgacgtccagacgggcaagggtgtcacg
gtcgacggggcaggccggttcaccgccaccctgggcgccggcacggccgtggccctgcac
gtcggcgcccgcacctgtgacggcggcgatcccggcgaccccgacccggtgtcctccggc
gtgtccttcgcggtcgacgccaccaccagctggggccagaacatctacgtgaccggcaac
cggccggaactgggcaactggaacccgggcggcgcccttcaactcgacccggccgcctac
ccggtgtggaagcgggacgtcgaactccccgagggcacgaccttcgagtacaagtacctc
cgcaaggacgacgcgggcaacgtgacctgggagagcggtgccaaccgcaccgcgacggtg
aacaccacgaagaccactctcaacgacacctggcgcaactga

DBGET integrated database retrieval system