KEGG   Streptomyces lividans: SLIV_04245Help
Entry
SLIV_04245        CDS       T03222                                 

Gene name
icd
Definition
(GenBank) Isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
slv  Streptomyces lividans
Pathway
slv00020  Citrate cycle (TCA cycle)
slv00480  Glutathione metabolism
slv01100  Metabolic pathways
slv01110  Biosynthesis of secondary metabolites
slv01120  Microbial metabolism in diverse environments
slv01130  Biosynthesis of antibiotics
slv01200  Carbon metabolism
slv01210  2-Oxocarboxylic acid metabolism
slv01230  Biosynthesis of amino acids
Module
slv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
slv_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:slv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SLIV_04245 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SLIV_04245 (icd)
Enzymes [BR:slv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     SLIV_04245 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH Pr_beta_C
Motif
Other DBs
NCBI-ProteinID: AIJ11872
UniProt: D6EDR8
LinkDB All DBs
Position
926273..928492
Genome map
AA seq 739 aa AA seqDB search
MTDSTIIYTHTDEAPALATYSFLPVVRAYASQAGVAVETRDISLAGRIIALFPEYLTEDQ
RIPDALAELGELAKTPAANIIKLPNISASIPQLKAAVAELQGQGYALPAYPDDPKTDEER
DIRARYDKVKGSAVNPVLREGNSDRRAPASVKNYAKTHPHRMGAWTGESKTNVATMGEND
FRSTEKSAVIAEDGTLRIELVGDDGTTTVLRESVPVKKDEVVDASVLRVAALREFLTAQV
ARAKAEGILYSVHLKATMMKVSDPIIFGHVVRAFFPKTFAQYGDVLAKAGLTPNDGLGGI
YKGLESLPEGAEIKASFDAELAEGPELAMVDSDKGITNLHVPSDVIIDASMPAMIRTSGH
MWGADGGEHDALAVIPDSSYAGVYQAVIEDCRANGAYDPSTMGSVPNVGLMAQKAEEYGS
HDKTFEIPTTGTVRLVDAAGNAVLEQTVSAGDIFRACQTKDAPIRDWVKLAVTRARATGD
PAVFWLDEGRAHDANLIAKVKQYLTEHDTEGLDIRILDPVEATKLSVERIRRGENTISVT
GNVLRDYLTDLFPILELGTSAKMLSVVPLMAGGGLFETGAGGSAPKHVQQLVKEDYLRWD
SLGEFFALVPSLEKYAEATGNGKAKVLADTLDRATATFLNEDKSPTRRVGGIDNRGSHFY
LSLYWAQELAKQTDDADLAKAFAPLAETLTASEQKIVEELNAVQGKPAEIGGYYQPDPAK
AAKIMRPSTTWNEALASLA
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
gtgactgactcgaccatcatctatacacacactgacgaggccccggccctggcgacgtat
tcgttcctgccggtggtccgggcgtacgcctcgcaggcgggtgtcgcggtcgagacccgc
gacatctcgctggccggccgcatcatcgccctgttcccggagtacctcaccgaggaccag
cgcatcccggacgccctcgcggagctgggcgagctggccaagacgcccgccgccaacatc
atcaagctgccgaacatctcggcgtccatcccgcagctcaaggccgccgtcgccgagctg
cagggccagggctacgcgctgccggcctacccggacgacccgaagaccgacgaggagcgc
gacatccgcgcccgctacgacaaggtcaagggctccgcggtcaacccggtcctgcgcgag
ggcaactccgaccggcgcgccccggcgtcggtgaagaactacgccaagacccacccgcac
cgcatgggcgcctggaccggcgagtccaagaccaacgtggcgaccatgggcgagaacgac
ttccgctccaccgagaagtccgcggtgatcgccgaggacggcaccctgcggatcgagctg
gtcggcgacgacggcaccaccaccgtgctgcgcgagtcggtgccggtgaagaaggacgag
gtcgtcgacgcctccgtgctgcgcgtcgccgccctgcgcgagttcctcaccgcgcaggtc
gcccgcgccaaggccgagggcatcctctactcggtgcacctgaaggccacgatgatgaag
gtctccgacccgatcatcttcggccacgtggtccgcgccttcttcccgaagaccttcgcc
cagtacggcgacgtgctcgccaaggccggcctcaccccgaacgacggcctgggcggcatc
tacaagggcctggagtccctgcccgagggcgccgagatcaaggcgtccttcgacgccgag
ctggccgagggcccggagctggccatggtcgactccgacaagggcatcaccaacctgcac
gtgccctcggacgtcatcatcgacgcgtccatgccggccatgatccgcacctccggtcac
atgtggggcgcggacggcggcgagcacgacgccctcgccgtgatcccggactcctcgtac
gccggtgtgtaccaggccgtcatcgaggactgccgcgccaacggcgcctacgacccctcc
accatgggttcggtcccgaacgtcggcctcatggcgcagaaggccgaggagtacggcagc
cacgacaagaccttcgagatccccaccacgggcaccgtccgcctggtcgacgccgcgggc
aacgcggtgctggagcagacggtctccgccggtgacatcttccgcgcctgccagaccaag
gacgcgccgatccgcgactgggtgaagctggccgtcacccgcgcccgcgccaccggcgac
ccggccgtcttctggctggacgagggccgcgcccacgacgccaacctgatcgccaaggtc
aagcagtacctgacggagcacgacaccgagggcctggacatccggatcctcgacccggtc
gaggcgaccaagctgtcggtggagcgcatccgccgcggcgagaacaccatctcggtcacc
ggcaacgtgctgcgcgactacctgaccgacctgttcccgatcctggagctgggcaccagc
gccaagatgctgtcggtcgtcccgctgatggcgggcggcggcctcttcgagaccggtgcc
ggcggttcggccccgaagcacgtgcagcagctggtcaaggaggactacctgcgctgggac
tcgctcggtgagttcttcgccctggtgccgtccctggagaagtacgccgaggccacgggc
aacggcaaggccaaggtcctcgccgacaccctcgaccgcgccacggcgacgttcctcaac
gaggacaagtccccgacccgccgcgtcggcggcatcgacaaccgcggcagccacttctac
ctgtccctgtactgggcgcaggagctggcgaagcagaccgacgacgcggacctggccaag
gccttcgccccgctcgccgagacgctcaccgcgagcgagcagaagatcgtcgaggagctg
aacgccgtccagggcaagccggccgagatcggcggctactaccagcccgacccggccaag
gccgccaagatcatgcgcccgtcgaccacctggaacgaggcgctggcgtccctcgcctga

DBGET integrated database retrieval system