KEGG   Streptomyces lividans: SLIV_04575Help
Entry
SLIV_04575        CDS       T03222                                 

Definition
(GenBank) fatty oxidation protein
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
slv  Streptomyces lividans
Pathway
slv00071  Fatty acid degradation
slv00280  Valine, leucine and isoleucine degradation
slv00281  Geraniol degradation
slv00310  Lysine degradation
slv00362  Benzoate degradation
slv00380  Tryptophan metabolism
slv00410  beta-Alanine metabolism
slv00640  Propanoate metabolism
slv00650  Butanoate metabolism
slv00903  Limonene and pinene degradation
slv00930  Caprolactam degradation
slv01100  Metabolic pathways
slv01110  Biosynthesis of secondary metabolites
slv01120  Microbial metabolism in diverse environments
slv01130  Biosynthesis of antibiotics
slv01200  Carbon metabolism
slv01212  Fatty acid metabolism
Module
slv_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:slv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SLIV_04575
   00650 Butanoate metabolism
    SLIV_04575
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SLIV_04575
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SLIV_04575
   00310 Lysine degradation
    SLIV_04575
   00380 Tryptophan metabolism
    SLIV_04575
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SLIV_04575
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SLIV_04575
   00281 Geraniol degradation
    SLIV_04575
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SLIV_04575
   00930 Caprolactam degradation
    SLIV_04575
Enzymes [BR:slv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SLIV_04575
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SLIV_04575
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SLIV_04575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 F420_oxidored DAO AlaDh_PNT_C NAD_binding_8 NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: AIJ11935
UniProt: A0A076LT07
LinkDB All DBs
Position
complement(996535..998736)
Genome map
AA seq 733 aa AA seqDB search
MDTTARPSTIRWEESEDGVVTLVLDDPGQSANTMNAAFIDSLDAVAQRLVERRDDIRGVV
VTSAKRSFFAGGDLRDLISVTPATAQQSFEAGMRVKRSLRALETLGRPVVAAINGAALGG
GYEIALACHHRVVLDTPAARVGLPEVTLGLLPGGGGVTRTVRMFGVVDALRTVLLEGTQY
GPVDALEAGLVDEIAADPDELLAKARAFVAARPESAQPWDRPGHRIPGGTPSHPKLAAQL
SALPALLRKRTGGAPGPAPRNILAAAVETAQVDLDTAFVVEARYLTELVTGQITKNMIQA
FFFDLQAVNAGANRPKGVEPGKVAKVAVLGAGMMGAGIAYSCARAGIDVVLKDVSLESAL
KGKAYSEKLCAKAVAKGRTSQEKAAALLARITPTAEAADLAGCDAVIEAVFEDTSLKHKV
FQEIEHVVAPDALLCSNTSTLPITALAEGVERQGDFIGLHFFSPVDRMPLVEIIKGERTG
DGALARAFDLVRQIGKTPIVVNDSRGFFTSRVIGHFIDEGVAMVGEGIEPASVEQAAAQA
GYPAKVLSLMDELALTLSRKIREETKRAVQEAGRTWEPHPADHVVDRMIDEFERPGRSGG
AGFYEYGEDGRRAGLWPGLREHFTKPGSEIPFADMQERMLFSEALDTVRLLEEGVLTSVA
DANIGSIFGIGFPGWTGGVLQYINGYDGGAGAGAGLPGFVARARELADRYGERFTPPPLL
LRKAERGETFTDF
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atggacaccaccgcacggccctccaccatccgctgggaggagtccgaggacggcgtcgtc
accctcgtcctggacgatccgggccagtccgccaacaccatgaacgccgcgttcatcgac
tcgctcgacgccgtcgcgcagcggctcgtggaacgccgtgacgacatccgcggcgtcgtc
gtcacctcggccaagaggagcttcttcgccggcggcgacctgcgcgacctgatctccgtc
accccggcgaccgcacagcagtccttcgaggcgggcatgcgcgtcaagcgctcgctgcgc
gccctggagaccctgggcaggcccgtcgtcgccgcgatcaacggcgccgccctcggcggc
ggttacgagatcgcgttggcctgccaccaccgcgtggtcctcgacaccccggccgcccgg
gtggggctccccgaagtcaccctgggcctgttgccgggcggcgggggagtgacccgcacc
gtccggatgttcggcgtcgtggacgcgctgcggaccgtcctcctggagggcacccagtac
gggccggtcgacgccctggaagccggactggtcgacgagatcgccgccgacccggacgaa
ctcctcgccaaggcacgggcgttcgtggccgcccgtccggagtccgcccagccctgggac
cggcccggccaccgcatccccggcggtacgccctcgcacccgaagctcgcggcccagctc
tccgcccttcccgcgctgctcaggaagcggaccggcggcgccccgggcccggccccgcgc
aacatcctcgccgcggccgtggagacggcccaggtcgacctggacacggcgttcgtcgtg
gaggcccgctacctgacggaactcgtcaccggtcagatcaccaagaacatgatccaggcg
ttcttcttcgacctgcaggcggtcaatgccggtgccaaccgtccgaagggtgtcgagccg
gggaaggtcgccaaggtggctgtgctgggtgcggggatgatgggtgcgggcatcgcctac
tcgtgtgcgcgtgcgggcatcgacgtggtgctgaaggacgtctccctggagtcggcgctc
aaggggaaggcgtattcggagaagctgtgcgccaaggccgtcgcgaagggccgtacgagt
caggagaaggcggccgcgctgctggcgcggatcacgccgacggccgaggcggccgatctg
gcggggtgcgacgcggtgatcgaggcggtgttcgaggacacttcgctcaagcacaaggtg
ttccaggagatcgagcacgtcgtcgcccccgacgcgctgctgtgctcgaacacctccacg
ctgccgatcacggcgctggccgagggggtggagcggcagggcgacttcatcgggctgcac
ttcttctctcccgtggacaggatgccgctggtggagatcatcaagggcgagcggaccggg
gacggggcgctggcccgcgccttcgacctggtccggcagatcggcaagacgccgatcgtg
gtcaacgactcgcggggcttcttcacctcccgggtcatcggccacttcatcgacgagggc
gtggcgatggtgggggagggcatcgagcccgcctcggtggagcaggcggcggcccaggcg
ggttacccggccaaggtgctgtccctgatggacgagctggccctcaccctctcccgcaag
atccgcgaggagacgaagcgggccgtccaggaggccgggaggacttgggagccgcacccc
gcggaccacgtcgtcgaccgcatgatcgacgagttcgagcgccccggacgcagtggcggc
gccgggttctacgagtacggcgaggacggcaggcgggccgggctgtggccggggctgcgt
gagcacttcacgaagccggggtccgagatcccgttcgccgacatgcaggagcggatgctg
ttctcggaggcgctggacaccgtccggctcctggaggagggggtgctgacctccgtcgcc
gacgccaacatcggctcgatcttcggcatcggcttccccggctggaccggcggcgtcctc
cagtacatcaacggatacgacggcggcgccggggcaggtgcgggcctgcccggtttcgtc
gcccgcgcccgcgagctggccgaccgctacggcgagcgcttcaccccgcctccgctgctg
ctgcgcaaggcggaacgcggtgagaccttcacggacttctga

DBGET integrated database retrieval system