KEGG   Streptomyces lividans: SLIV_04970Help
Entry
SLIV_04970        CDS       T03222                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
slv  Streptomyces lividans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AIJ12012
UniProt: A0A076LZ65
LinkDB All DBs
Position
1085479..1086531
Genome map
AA seq 350 aa AA seqDB search
MPPVKPMLAKSVAKIPPGMHYEAKWDGFRAIVYRDGDEVELGSRTGKPLTRYFPELVVAV
RERLPERCVVDGEIVIARDGHLDFDALTERIHPADSRVRTLAERTPASLVAFDLLALDDA
SLLDVGLADRRALLVRALSGVTPPVHVAPATDDIEVARRWFEQYEGAGLDGVVAKPLDLR
YRQDERAMYKIKHERTADVVVAGYRFHKSGPVVGSLLLGLYDDRGLLQHVGVSAAFTMKR
RAELVAELEPLRMDDAGGHPWAAWAEEAAHESARLPGAPSRWSGKKDLSWVPLRPERVVE
VAYDHMENGARFRHTARFRRWRPDRTPESCTYAQLEEPVRYDLAEILGGP
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccgtgaagccgatgctcgccaagtccgtggcgaagatcccgccggggatgcac
tacgaggccaagtgggacggcttccgtgcgatcgtgtaccgcgacggggacgaggtggag
ctggggagccgtacgggcaagccgctgaccaggtatttcccggagctggtggtggcggtg
cgggagcggctgcccgagcggtgcgtggtggacggggagatcgtcatcgcgcgggacggt
cacctggacttcgacgcgctcaccgagcggatccatccggccgactcccgggtgcggacc
ctcgcggagcgcacgccggcctcgctggtggccttcgacctgctggcgctggacgacgcg
tccctgctcgacgtggggctggccgaccggcgggcgctgctggtgcgggcgctgtcgggg
gtgacgccgccggtgcacgtggcgccggcgacggacgacatcgaggtggcccggcggtgg
ttcgagcagtacgagggggcggggctcgacggcgtcgtcgccaagccgctcgatctgcgc
taccggcaggacgagcgggccatgtacaagatcaagcacgagcggacggcggacgtcgtc
gtcgccgggtaccgcttccacaagagcgggcccgtggtcggctcgctgctgctcggtctg
tacgacgatcgggggctgctccagcacgtgggggtgagtgccgccttcacgatgaagcgc
cgggccgagctggtggcggagctggaaccgctgcgcatggacgacgccggggggcatccg
tgggccgcctgggccgaggaggcggcgcacgagtcggcgcggctgcccggcgcgccgagc
cgctggtcgggcaagaaggacctgtcctgggtgccgctgcgtcccgagcgggtggtcgag
gtggcgtacgaccacatggagaacggggcgcgcttcaggcacacggcccgcttccgccgc
tggcgcccggaccggacccccgagagctgcacctacgcgcagctggaggagccggtccgc
tacgacctggcggagatcctcggcgggccctga

DBGET integrated database retrieval system