KEGG   Streptomyces lividans: SLIV_09145
Entry
SLIV_09145        CDS       T03222                                 

Definition
(GenBank) polyketide synthase
  KO
K21792  polyketide synthase
Organism
slv  Streptomyces lividans
Pathway
slv00333  Prodigiosin biosynthesis
slv01100  Metabolic pathways
slv01110  Biosynthesis of secondary metabolites
Module
slv_M00838  Undecylprodigiosin biosynthesis, L-proline => undecylprodigiosin
Brite
KEGG Orthology (KO) [BR:slv00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SLIV_09145
SSDB
Motif
Pfam: AMP-binding ketoacyl-synt Acyl_transf_1 Aminotran_1_2 Ketoacyl-synt_C PP-binding KAsynt_C_assoc Thiolase_N Cys_Met_Meta_PP Aminotran_5
Other DBs
NCBI-ProteinID: AIJ12834
UniProt: A0A076M516
LinkDB
Position
complement(2089522..2096415)
AA seq 2297 aa
MARNRREKNVSHGPTDPLHEHWQGPEPETVTALLRHRAEHTPDALAHRFLTDTDGTSVAW
TYRELDLHAREVATHLRHAGVGQGPVLLLHPPGLDYLAAFFGCLYAGAVAVPAYPPDNAR
FGQTVPRLAAIARDCAATHALTTRRVRETVAADGTGRVGTELDGVRWLVTEDLYTGESTT
AWEDPGATARSLAFLQYTSGSTAAPKGVMVEHGNLVRNLRSIHLRLGHDADSGMVSWLPP
YHDMGLIGGILTPVYGGFPAHLMAPMTFVQRPLLWLETLSRTGASTSVAPNFGFEQCLRR
ITPAQRAGLDLSRWRLALNGAEPIRPDTLDRFAEYFAPAGFDRTALLPCYGLAEATLMVT
GVRPADPPVVESFDAAALEAGTARPADPGGVRTTRVVGCGAPVADVEVAVVDAATGRRVP
DGTVAEIRVSGPGVARGYWGRPEAAAEVFGTRIDGEPGNAWLRTGDVGFRHDGQLYVVGR
TKDVIIVQGRNIHPQDVEQTAERVGAGLRAGYGAAFAVPTADGEQLALAYEIGGPGAGDP
HALLARLRTAIADEHQVTPHTVVLLKRSSVPRTTSGKIQRGACRQRLLDLELPVVAASVV
QDGGLPDTPAPHAPASPDRTAALVADALDRAATDAPDGTSRYPRLLTAVRTLSERLGVAL
DVGELLSGPEPDGAPSLTGLCRAALADAAPAPTAAPERTRTQAVDWLRRAVAARLGLRPS
VIDTTVPFTSLGLDSKQAVALTAPFGDWLGTPVTPATLYDHPTVESLAAHVTGPEADGTP
HPHPRRPAPEPARGRADEPVAVIGIGCRFPGAPDPDSYWRLLRDGRDAVGEAPADRHGDT
GGRPGGFLEHVYDFDARFFGVSARETERMDPQQRLLLEVAWQTFEDAGIAPSSLAGTDTG
VFVGISGHDYADLQMPHPDVVDMYSATGNAQSVAAGRLSYFFDLTGPSLALDTACSSSLA
AVHTAMRSLRDGECGVALAGGVNLMLTPGLSEALARGGMLGPGGRCRTFDDGADGYVRGE
GAGLVCLKPLSAALADGDRVHAVLTGSALGHGGRANGLTAPRSTAQRAVMTGALERAGVQ
PGQIDYVEAHGTGTALGDPIEWEALTGVYGRGRPADAPCPVGSVKTAIGHLEAAAGIAGL
IKAVLVVREREVPPLLHLTTPNRHLDWTGSGLTVPTTRRALPAGGTLRAGVSSFGFGGTN
AHVIVESAPAPPAPAGESGAPDGTVHALSLSAHTESALATLAGRYRTHLAAHPGVPLAAL
CHSARTGRSRLPHRAVLTAATRDELDTALEALIRREPAVDVARGGPADGTAPTVAFLFGG
QGTQYPGMGRDLYDAHPVLARTLRRADAVLRGLGEIPLLDLLFDPDRAEDLARTRYCQPA
LVALEVALADLWTSCGVRPAAVLGHSVGALAAACVAGVLSLEDALTLAVVRGRAMDEQPG
EGAMIACVGDPETVREIAAGHDRVALAAVNAPRNLVFSGAADRIAALRGDLERKGVTVRP
LAVSHAFHSPLMAGAAEPLLEAARAVEFQPPAIPWISDATGEPVTRVDAEYWVHHLLGTV
RFADGFARLRAGNAEGGPGCDAFVEIGPHPTLLNLGRSAVANGPEPDGRPTLWLPSLRRG
APGRRTLLRSLGGYQCAGGDVDWSALDGEHPPARVPLPHTPFERRTYRFQAPTPDQEGDP
MPSQPTVPGTAPTGPAGEVSRTVLDTVARVCGFPVADLPVHARLGLELGFDSLMRTDLQR
RLTDRFPQRMHTLQDLPEDPTVQDIIGRLAAGDDRDGDPAGGAHTARPALAGTGPAAPPA
HPAAVPAAPPVPAPQYAPYGAFPAPPHGYAVAAPVPQPGVPYPYPYGYPPHGAPGYAYYV
PQPYPPQAFPPPEPPSPVQAAPAPVPAAAPAPVPDPVPAPAAPVRQERAFEDWAEYAELQ
GRLRQTRTSGSNPYGRTHEGFNSALATVDGTKVVNFAAFNYLALSHHPRVRQAAKDAVDR
YGTSASATPLLFGETPLHHELEAEIARFIGTEAAIVFAGGHATNVATVGHLFGPEDLVVH
DAWIHDSTVRGCILSGARRRSFPHNDWAALDRILTGARASHRRALVVIEGAYSQDGDIPD
LPRFIEVKKRHGAMLMIDEAHSIGVLGRTGRGVGEHYGTDPADVDLWMGTLSKALGSLGG
YIAARRPIIEYLKFTAPLHIFSTGISPANAAAALEALRVVQDEPERVARVQELAEFFRAG
ARARGLDVGVSRLSAVIPVITGDWEKTMALSNSLLERGVNVMPIGYPAVPRDQCRLRFFI
NADHSEADLEHSLDLLV
NT seq 6894 nt   +upstreamnt  +downstreamnt
atggcccggaaccgcagggagaagaacgtgagccacgggccgacggacccgctgcacgag
cactggcagggacccgaaccggagacggtcacggccctgctgcggcaccgggcggaacac
acacccgacgccctcgcccaccgcttcctcaccgacaccgacggcacgtccgtcgcctgg
acctaccgcgaactcgacctgcacgcccgcgaggtggccacccacctgcggcacgccggg
gtggggcagggcccggtgctgctgctgcacccgccgggcctcgactacctcgccgcgttc
ttcggctgcctgtacgccggcgccgtggccgtccccgcctacccgccggacaacgcccgg
ttcggccagaccgtgccccggctcgcggccatcgcccgggactgcgccgccacccacgcc
ctcaccacccgccgggtccgcgagaccgtcgccgccgacggcaccggccgggtcggcacc
gaactcgacggcgtgcgctggctggtgaccgaggacctctacaccggcgagtccaccacc
gcctgggaggaccccggagccacggcgcggtcgctggccttcctccagtacacctcgggt
tccaccgccgcgcccaagggcgtgatggtcgaacacggcaacctggtgcgcaacctgcgc
tccatccacctcaggctcgggcacgacgcggactccggcatggtctcctggctgccgccg
taccacgacatgggtctcatcggcggcatcctcaccccggtgtacggcggcttccccgcg
cacctcatggcgccgatgaccttcgtgcagcgcccgctgctgtggctggagaccctctcc
cgcaccggcgcctccaccagcgtggcacccaacttcggcttcgagcagtgcctgcgccgg
atcacccccgcgcagcgggccggcctggacctgagccgctggcgcctggcgctgaacggt
gccgagccgatccgccccgacaccctcgaccggttcgccgagtacttcgccccggccggc
ttcgaccgcaccgcgctgctgccctgctacggcctcgccgaggcgaccctcatggtcacc
ggcgtgcggccggccgacccgccggtggtggagtccttcgacgcggcggccctggaggcg
ggcaccgcgcgtcccgcggaccccggcggcgtgcgcaccacccgcgtcgtcggctgcgga
gcacccgtcgccgacgtcgaggtcgcggtggtcgacgccgccaccggccgccgggtcccc
gacggcaccgtcgccgagatccgggtcagtggtcccggcgtcgcccgcggctactgggga
cgccccgaggccgccgccgaggtcttcggcacccggatcgacggcgaaccgggcaacgcc
tggctgcgcaccggcgacgtcgggttccgccacgacggccagctctacgtggtcggcagg
accaaggacgtgatcatcgtccagggccgcaacatccacccccaggacgtggaacagacg
gccgaacgggtcggcgccggactgcgcgccgggtacggcgccgcgttcgccgtccccacc
gccgacggcgaacagctcgccctcgcctacgagatcggcgggcccggcgccggggatccg
cacgccctgctcgcccggctgcgcaccgccatcgccgacgagcaccaggtgacaccgcac
accgtcgtgctgctcaaacgctcctcggtgccgcgcaccaccagcggcaagatccagcgc
ggcgcctgccggcagcgcctgctcgacctggaactgcccgtggtggccgcgagcgtcgtc
caggacggtggcctgccggacacccccgccccgcacgcccccgcctccccggaccgtacg
gccgccctcgtcgccgacgccctcgaccgcgccgcgacggacgcgcccgacggcacctcg
cgctacccgcggctgctgaccgccgtacggacgctgtccgagcgcctcggcgtcgccctc
gacgtcggtgaactcctgtccggccccgagccggacggcgcgccgtccctcaccgggctg
tgccgcgccgcgctcgccgacgcggcgcccgcgcccacggccgcgccggagcggacccgg
acccaggccgtggactggctgcggcgggccgtcgccgcccggctgggcctgcgcccctcg
gtgatcgacacgacggtccccttcacctcactgggcctggactccaagcaggccgtggcc
ctcaccgccccgttcggcgactggctcggcacccccgtcaccccggccaccctctacgac
cacccgacggtcgagtccctggcggcccacgtcaccggaccagaggcggacggcaccccg
cacccgcacccgcggcgtcccgcccccgagcccgcccgcgggcgcgccgacgagcccgtc
gccgtgatcggcatcggctgccggttccccggcgcacccgaccccgacagctactggcgg
ctgctgcgcgacggccgcgacgccgtgggcgaggcacccgccgaccgccacggcgacacc
ggcggccggccgggcggcttcctggagcacgtgtacgacttcgacgcccgcttcttcggc
gtctccgcccgcgagaccgaacgcatggacccccagcagcggctgctcctggaggtcgcc
tggcagaccttcgaggacgcgggcatcgcgccctcctccctggccggcacggacaccggt
gtcttcgtcggcatcagcgggcacgactacgccgatctccagatgccgcaccccgacgtc
gtcgacatgtactccgccaccggcaacgcccagtccgtggcggccggccggctctcgtac
ttcttcgacctgaccgggcccagcctcgccctcgacaccgcctgctcctcctcgctcgcc
gccgtccacacggcgatgcgcagcctgcgggacggcgagtgcggcgtcgccctcgcgggc
ggcgtcaacctgatgctgacgcccgggctgtcggaggccctcgcccggggcggcatgctc
ggccccggcggacgctgccgcaccttcgacgacggcgccgacggctacgtccgcggcgag
ggcgcgggcctggtgtgcctcaagccgctgtccgccgcgctggccgacggggaccgcgtg
cacgccgtgctcaccggctccgcgctcggtcacggcggccgggccaacggcctgaccgcc
ccccgcagcaccgcccagcgtgccgtgatgaccggggcgctggagcgggccggtgtgcag
cccggacagatcgactacgtcgaggcacacggcaccggcaccgctctcggcgaccccatc
gagtgggaggccctgaccggcgtctacggccgcggccgccccgccgacgcgccctgcccg
gtcggctcggtgaagaccgccatcggccacctggaggcggccgccggcattgccgggctg
atcaaggccgtgctcgtggtgcgggagcgggaggtaccgccgctgctgcacctgaccacc
cccaaccggcacctggactggacgggttcgggactgaccgtgcccaccacccgccgggcc
ctgcccgccgggggcaccctgcgcgcgggcgtcagctcgttcggcttcggcggcaccaac
gcccatgtgatcgtcgagtccgcgcccgcacccccggcgcccgccggcgagtccggcgcc
cccgacggcacggtgcacgccctgtccctgtccgcgcacaccgagtccgccctggccacc
ctggccggccgctaccgcacccacctcgcggcccaccccggcgtgccgctcgccgccctg
tgccactccgcccgcaccggccgttcccggctgccgcaccgggcggtcctcaccgcagcg
acccgggacgaactggacaccgcactggaggcgctgatccgccgggagcccgccgtggac
gtggcccgcggcggacccgcggacggcaccgcgcccaccgtcgccttcctcttcggcggc
cagggcacccagtacccgggcatgggccgcgacctctacgacgcccaccccgtcctcgcc
cgcaccctgcggcgcgccgacgcggtgctgcgcggcctgggcgagatcccgctgctcgac
ctgctcttcgacccggaccgcgccgaggacctggcccgcacccggtactgccagcccgcc
ctggtcgccctcgaagtcgccctcgccgacctgtggacgagctgcggagtacgcccggcg
gccgtgctcgggcacagcgtcggcgccctcgccgccgcctgcgtcgccggtgtcctctcc
ctggaggacgccctcacgctggcggtcgtccgcgggcgtgccatggacgaacagcccggc
gagggcgcgatgatcgcctgcgtcggcgatccggagacggtgcgcgagatcgccgccggc
cacgaccgggtggccctcgccgccgtcaacgcgccccgcaacctggtgttctccggcgcg
gccgaccggatcgcggcactccgcggcgacctggaacgcaagggggtcaccgtccggccg
ctcgccgtctcgcacgccttccactcaccgctgatggcgggcgccgccgagccgctgctg
gaggccgcgcgcgccgtcgagttccagcccccggccatcccgtggatctccgacgccacc
ggcgaacccgtgacccgggtcgacgccgagtactgggtccaccacctgctcggcaccgtg
cgcttcgccgacggcttcgcccgcctgcgcgcggggaacgccgaaggcggtccgggctgc
gacgcgttcgtcgagatcggcccgcaccccaccctgctgaacctcggccggtccgccgtc
gccaacggccccgagcccgacggacgccccacgctgtggctgccctcgctgcgccgcggc
gcccccggccgccgcaccctgctgcggtcgctgggcggctaccagtgcgcgggcggagac
gtcgactggtccgccctggacggcgaacacccgcccgcccgggtcccgttgccgcacacg
cccttcgaacgccggacctaccggttccaggcccccactcccgatcaggaaggcgatccc
atgccgtcccagcccacggtgccgggcaccgccccgacgggccccgcgggcgaggtctcc
cgcaccgtgctcgacaccgtcgcccgcgtctgcggattccccgtggccgacctgccggtg
cacgcccggctcggcctcgagctgggattcgactccctgatgcggaccgacctccagcgc
cgtctcaccgaccgcttcccccaacggatgcacacgctccaggatctgccggaggacccc
acggtgcaggacatcatcggccggctcgccgccggcgacgaccgcgacggcgaccccgcc
ggcggcgcccacaccgcccgccccgccctcgccggcaccggcccggccgcgccgccggcc
caccccgcggccgtaccggcggcgccgcccgtcccggccccgcagtacgccccgtacgga
gccttcccggccccgccccacggctacgccgtcgccgccccggtcccgcagcccggagtg
ccgtacccgtacccgtacggctacccgccgcacggtgctcccgggtacgcctactacgtc
ccccagccctaccccccgcaggcgttcccgcccccggaacccccctccccggtgcaggcg
gcccccgcccccgtacccgccgcagcccccgcccccgttcccgacccggttccggcgccc
gccgcccccgtacgtcaggagcgcgccttcgaggactgggcggagtacgcggaactccag
ggcagactccgccagacccggaccagcgggtccaatccctacggccgtacgcacgagggc
ttcaactccgcgctcgccacggtcgacggcaccaaggtcgtcaacttcgcggccttcaac
tacctggcgctctcccaccacccccgcgtgcgccaggcggccaaggacgccgtggaccgc
tacggcacctccgcctccgccaccccgctgctgttcggcgagaccccgctgcaccacgaa
ctcgaagccgagatagcacggttcatcggtaccgaggcggccatcgtgttcgccggcggc
cacgccaccaacgtcgccaccgtcggccacctgttcggcccggaggacctggtggtgcac
gacgcctggatccacgacagcaccgtgcgcggctgcatcctctcgggcgcccggcgccgg
tccttcccgcacaacgactgggccgccctcgaccgcatcctgaccggagcacgggcctcg
caccgcagggcgctcgtcgtcatcgagggcgcctacagccaggacggcgacatccccgac
ctgccgcgcttcatcgaggtcaagaagcgccacggcgccatgctgatgatcgacgaggcg
cactccatcggcgtcctgggccgcaccggccgcggcgtgggcgagcactacggcaccgac
ccggccgacgtcgacctgtggatgggcaccctcagcaaggcgctgggcagcctcggcggg
tacatcgccgcccgccgcccgatcatcgagtacctcaagttcaccgcgccgctgcacatc
ttctccaccggcatctccccggcgaacgccgccgccgccctggaggcgctgcgggtcgtc
caggacgagcccgagcgggtcgcccgggtgcaggagctggccgagttcttccgcgcaggc
gcccgcgcccgcggcctcgacgtcggcgtctcccgcctctccgcggtgatcccggtgatc
accggtgactgggagaagacgatggcgctctccaactcgctgctggagcgcggcgtcaac
gtcatgccgatcggctaccccgccgtcccgcgcgaccagtgccggctccgcttcttcatc
aacgcggaccacagcgaagcagacctcgaacactccctcgacctcctggtgtga

DBGET integrated database retrieval system