KEGG   Streptomyces lividans: SLIV_12095Help
Entry
SLIV_12095        CDS       T03222                                 

Gene name
sodN
Definition
(GenBank) Superoxide dismutase [Ni]
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
slv  Streptomyces lividans
Brite
KEGG Orthology (KO) [BR:slv00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SLIV_12095 (sodN)
Enzymes [BR:slv01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SLIV_12095 (sodN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni
Motif
Other DBs
NCBI-ProteinID: AIJ13412
UniProt: D6EUN3
LinkDB All DBs
Position
2781543..2781938
Genome map
AA seq 131 aa AA seqDB search
MLSRLFAPKVTVSAHCDLPCGVYDPAQARIEAESVKAVQEKMAGNDDPHFQTRATVIKEQ
RAELAKHHVSVLWSDYFKPPHFEKYPELHQLVNDTLKALSAAKGSKDPATGQKALDYIAQ
IDKIFWETKKA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgctttcccgcctgtttgcccccaaggtcacggtcagcgcccactgcgacctgccctgc
ggcgtgtacgaccctgcccaggcccgcatcgaggcggagtcggtgaaggccgtccaggag
aagatggccggcaacgacgacccgcacttccagacgcgcgccacggtcatcaaggagcag
cgcgccgagctcgcgaagcaccacgtctccgtgctgtggagcgactacttcaagcccccg
cacttcgagaagtacccggagctgcaccagctggtcaacgacaccctgaaggccctgtcg
gccgccaagggctcgaaggacccggcgaccggccagaaggccctggactacatcgcccag
atcgacaagatcttctgggagaccaagaaggcctga

DBGET integrated database retrieval system