KEGG   Synechococcus lividus: BRW62_03955Help
Entry
BRW62_03955       CDS       T05303                                 

Definition
(GenBank) RNB domain-containing ribonuclease
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
slw  Synechococcus lividus
Brite
KEGG Orthology (KO) [BR:slw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:slw03016]
    BRW62_03955
Enzymes [BR:slw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     BRW62_03955
Transfer RNA biogenesis [BR:slw03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    BRW62_03955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB
Motif
Other DBs
NCBI-ProteinID: ATS18041
UniProt: A0A2D2Q0K2
LinkDB All DBs
Position
complement(813093..815120)
Genome map
AA seq 675 aa AA seqDB search
MEKGTLIEFRVQNQRRLATIDRPEGKKLWIAMDQHLQSHTLHPRHITFTVPHERFRPQDI
PAFWQQVQSLLDPESLEVAWEIIREEQRTITPQGLAELLFGETTAATCYAAYYLLSEDRF
YFKLKGEVYEPRSVAQVAELKHQHEKEAQRLAEEATFTEHLAQALAGEAVQWSAGDRKRL
EQLERYAIAIETSAQHQGAVELLRQLKRPTQPLGAFQLLVDLGLWSTHENLFLRRSQIQV
EFSAKVLDVAHNCLNSPPTDIDADLRRDLTHLKVYTIDDESTQEIDDGLSVEVVGDRQKL
WIHIADPSRWVMADDVLDHEARRRATTVYLPTGIIPMFPSELATGPMSLVEGRLCCALSF
GILLAESGEVLEYEICPSWIRPTYRLSYDDVDMILEQAVPAEADLLAIAHWGNRRSQWRQ
QRGAIRIDIPEPSIKVAGEEVEISPLRDSPARQLVAEMMILAGEVAADYGLREGIPLPFR
CQSPPELPPDDELRQLPAGVVRDCAIRRCMPRSEMSTQPNPHASLGLDAYCQVTSPIRRY
TDLLAHRQIKAHLRGETPPLTPEQLNELLLRLVSSIQESSLVERQTNRYWCLEYLRRHRD
EVWRGILLRWLRPEENLGLVLLEDLGVELAMRLQRQANLGESLLVRASRVDPRSDQIWLE
EVSEVPSSPAATVTP
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
gtggagaaaggcaccctcattgagtttcgggtacagaatcagcggcggttagcgaccatc
gatcgccctgaaggtaaaaagctgtggattgctatggatcaacacctacaatcccatacc
ctacatcctcgccacattacctttaccgttccccatgaacggtttcgtccccaagatatt
cctgcattttggcagcaggtgcagtccctccttgatcctgagagccttgaagtcgcatgg
gaaattatccgcgaagagcagcgtaccattaccccgcaggggttagcggaactcttgttt
ggcgaaaccactgccgccacctgctacgcggcctattatttactgagtgaagaccgtttt
tatttcaaactcaaaggcgaggtgtatgagcctcgctctgtggctcaagtggcagagcta
aagcaccaacatgagaaggaagcccaacgcttggcagaggaggccaccttcacggaacat
ttagcccaggccttggcgggagaggcggtgcagtggtccgcaggagatcgcaagcgcctt
gaacaattagagcgttatgctatagccattgaaaccagtgcccagcatcaaggtgcggtg
gagttactccgtcaactgaagcgacccactcaaccccttggtgcctttcaactactggtg
gatttggggctgtggtcaacgcacgaaaatctttttctgcgccgtagccagattcaagtt
gaattttctgccaaggtacttgatgtggctcataactgcctaaactcaccaccaacggat
atagatgctgacctacgccgggatctgacgcatctgaaggtctataccattgacgatgaa
agtacccaagaaattgacgatggtttgagtgttgaagtcgtgggcgatcgccaaaagctg
tggattcatattgcggatccaagccgctgggtgatggccgatgatgtgctagaccatgaa
gcccgccgccgcgccacgaccgtgtatttacccacgggcatcattcccatgtttccctcg
gagttggccacaggcccgatgagcttggtggaagggcgtctctgctgtgctttgagtttt
ggcatcctcttggccgagagcggcgaagtcctcgaatacgaaatttgcccaagctggatt
cgccccacctaccgcctaagctacgatgatgtggatatgatcttagagcaggcggtgccc
gccgaagccgatctgctggcgatcgcccactggggcaaccgccgtagccaatggcggcaa
cagcgcggcgccatccgtattgatattcctgagccgagtattaaggtcgccggtgaggag
gtggagatctccccgctgcgggactcgccagcgcgacaactggttgcggaaatgatgatt
ttagctggcgaagtagcagcggattacggtttgcgcgaagggattcccttgccctttcgc
tgtcaatctccaccagagttgccccccgacgacgaattacgccaacttcccgctggcgtc
gtgcgcgactgtgccattcgtcgctgtatgcctcgcagtgaaatgagcacccagcctaac
ccccacgccagtttaggcctagatgcctactgccaagtaacctccccaatccgtcgctat
accgatttgctggcgcaccgccaaattaaagcccatctgcgcggcgaaacaccccccctt
accccagagcaactgaacgaactactgctgcgactcgtttcctccattcaagagtcatcc
ttagtggagcgacaaaccaatcgctactggtgccttgagtacctgcgccgccaccgcgat
gaagtgtggcggggaatcttactgcgctggttgcgaccagaggagaacttgggtttagtg
ctcttagaagacttgggggtagagttggccatgcgtttgcagcgccaagcaaacttgggt
gaatcgctgctagtgcgcgccagtcgggttgatccccgcagtgatcaaatttggctggag
gaagtctcagaggttccgtcttcgccggcggcgacggttacgccataa

DBGET integrated database retrieval system