KEGG   Synechococcus lividus: BRW62_04285Help
Entry
BRW62_04285       CDS       T05303                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
slw  Synechococcus lividus
Pathway
slw00061  Fatty acid biosynthesis
slw00780  Biotin metabolism
slw01100  Metabolic pathways
slw01130  Biosynthesis of antibiotics
slw01212  Fatty acid metabolism
Module
slw_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:slw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BRW62_04285
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BRW62_04285
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    BRW62_04285
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:slw01004]
    BRW62_04285
Enzymes [BR:slw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BRW62_04285
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     BRW62_04285
Lipid biosynthesis proteins [BR:slw01004]
 Fatty acid synthase
  Component type
   BRW62_04285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: ATS18095
UniProt: A0A2D2Q0Q3
LinkDB All DBs
Position
complement(879156..879935)
Genome map
AA seq 259 aa AA seqDB search
MLLDLSGKRALVTGIANNRSIAWGIAQQLHAAGAELAVTYLPDERGKLKQKVEELTAPLS
PKLVLPLDVQQPQQITDAFESLAAAWGGLDILIHCLAFAQKEDLSGDFSAVSVEGFNLAL
DISAYSLIALSRAAKPLMTSGGAIVTLTYLGGVRVVPNYNVMGIAKAALEMNVRYLAAEL
GAQGVRVNGISAGPIRTLASSAVGGILDMIHHVEATAPLRRTVTQTEVGNAAAFLASDLA
SGITGQILYVDSGYCIMGI
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgctcctagacctgtcgggaaaacgcgctcttgtcacggggattgcgaataatcgctcc
attgcgtggggcattgcccagcaactccatgccgctggtgctgaactggctgtaacgtac
ctgcctgatgagcgcggcaagcttaaacaaaaggttgaagaactgactgcccccctgagt
ccaaagcttgtattgcccctcgatgtgcagcagccccagcagatcacagatgcgtttgaa
tcacttgcagccgcatggggagggctggatattttgattcactgcctcgcctttgcccaa
aaagaggatctgagtggggatttttctgcggtgtctgtggaggggtttaaccttgccctt
gatattagtgcctattccctcattgccctcagtcgtgctgctaagcccctaatgacaagc
ggtggggcgattgttaccctcacctacttgggaggggtacgggttgtgcctaactataat
gtcatgggtattgccaaggccgccttggaaatgaatgtgcgttaccttgctgcggaattg
ggcgctcagggggtacgggtaaacggtatttcggcagggcctattcgcacccttgcctct
tccgccgtcggtggcatccttgacatgattcaccatgttgaggcaacagcccctctgcgt
cgcacggtcacccaaaccgaagtgggcaatgccgctgcctttttggccagtgacttagcg
agcggcattaccggacagattctttacgtggattcgggctattgcattatgggcatttga

DBGET integrated database retrieval system