KEGG   Synechococcus lividus: BRW62_04585Help
Entry
BRW62_04585       CDS       T05303                                 

Definition
(GenBank) aspartate aminotransferase
  KO
K00812  aspartate aminotransferase [EC:2.6.1.1]
Organism
slw  Synechococcus lividus
Pathway
slw00220  Arginine biosynthesis
slw00250  Alanine, aspartate and glutamate metabolism
slw00270  Cysteine and methionine metabolism
slw00330  Arginine and proline metabolism
slw00350  Tyrosine metabolism
slw00360  Phenylalanine metabolism
slw00400  Phenylalanine, tyrosine and tryptophan biosynthesis
slw00401  Novobiocin biosynthesis
slw01100  Metabolic pathways
slw01110  Biosynthesis of secondary metabolites
slw01130  Biosynthesis of antibiotics
slw01210  2-Oxocarboxylic acid metabolism
slw01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:slw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BRW62_04585
   00270 Cysteine and methionine metabolism
    BRW62_04585
   00220 Arginine biosynthesis
    BRW62_04585
   00330 Arginine and proline metabolism
    BRW62_04585
   00350 Tyrosine metabolism
    BRW62_04585
   00360 Phenylalanine metabolism
    BRW62_04585
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BRW62_04585
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    BRW62_04585
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:slw01007]
    BRW62_04585
Enzymes [BR:slw01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     BRW62_04585
Amino acid related enzymes [BR:slw01007]
 Aminotransferase (transaminase)
  Class I
   BRW62_04585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ATS18142
UniProt: A0A2D2Q0U7
LinkDB All DBs
Position
940759..941922
Genome map
AA seq 387 aa AA seqDB search
MELATRVMRVTPSVTLMIDAKAKAMRAAGEDVCSFSAGEPDFDTPAHIRDAAKMALDQGK
TRYGPAAGEPALRQAIADKLRTENHLPYTAENILVTNGGKQSLFNLMLALINPGDEVIIP
APYWVSYPEMVHLASGTPVIVHTTAETGYRITPAQLEAAITPKTRLFVLNSPSNPTGMVY
TPAEIRALAEVVVRHRLWVVSDEIYEKILYDEAEHLSIGAVSDAAFSYTIVSSGFAKAYA
MTGWRVGYLAGSAELIKATTKIQGHSTSNVCTFAQYGAIAALQGSQDCVAQMLAAFRQRR
QRMYAGITGIPQLRCVQPQGAFYLFVDIAKTGLSSVEFCDRLLEEAKVATIPGKAFGMDD
HIRLSYATDIETIEKGLERLAAFVAQL
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggagttggcaacgcgggtgatgcgggtcacgccgtcggtaactttaatgattgatgcc
aaagcaaaggccatgcgagccgcaggggaagatgtttgtagctttagtgccggagaaccg
gactttgacacccctgcccacatccgcgacgctgctaagatggctctggatcaaggcaaa
acccgttatgggccagcagcaggcgaacccgccttacgtcaagccattgccgacaaactc
agaactgagaaccacctcccttacaccgctgaaaacattcttgtgaccaatggcggcaag
cagtccctttttaacttaatgctggcgctgatcaaccctggggatgaggtcattattcca
gcaccctattgggtcagctatccagaaatggtgcatttggcgagtggcacgcctgtcatt
gtccacaccactgctgaaacaggctaccgcattacccccgctcaactggaggcggcgatc
acccccaaaacccgcctgtttgtcctcaactcccccagcaaccccacgggtatggtctat
accccagcggaaattcgggcattggcagaggtcgttgtgcgccatcggttgtgggtggtg
tcggatgaaatttatgaaaaaattctctacgatgaggcagaacacttaagtattggtgct
gttagcgacgctgcctttagctacaccattgtcagcagtggttttgcgaaggcctacgcc
atgacagggtggcgagtggggtaccttgctggttccgctgagctgattaaagccacgaca
aaaattcaggggcacagcacctcgaatgtctgcacgtttgcgcagtacggggcgatcgcc
gctctccaaggcagccaagattgcgtcgcccagatgctagcagcctttcgccagcgtcgc
cagcggatgtatgccggaattacaggcattccccaactgcgttgcgtccaaccccaaggg
gcattttatctatttgtggacattgccaaaaccgggctgagttccgtggagttttgcgat
cgcctcctcgaagaggccaaagtagccactattccaggtaaagcctttggcatggatgat
catattcgcctgtcctatgcgacggatattgaaacgatagaaaaggggttggagcggcta
gcagcgtttgtcgcccaactgtga

DBGET integrated database retrieval system