KEGG   Synechococcus lividus: BRW62_04610Help
Entry
BRW62_04610       CDS       T05303                                 

Definition
(GenBank) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
slw  Synechococcus lividus
Pathway
slw00040  Pentose and glucuronate interconversions
slw00051  Fructose and mannose metabolism
slw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BRW62_04610
   00051 Fructose and mannose metabolism
    BRW62_04610
Enzymes [BR:slw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     BRW62_04610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 2-Hacid_dh_C CoA_binding DUF1161
Motif
Other DBs
NCBI-ProteinID: ATS18146
UniProt: A0A2D2Q0Y5
LinkDB All DBs
Position
complement(946906..947958)
Genome map
AA seq 350 aa AA seqDB search
MKAQVFRGVNQLSYEELPIPEIAADEVLVRVKVVGLCQSDIKKIRYPLYEPPRIFGHETA
GEIAAVGTAVKGWQVGQRVVVMHHIPCMHCTYCLNENYSMCHVYKTITTTAGFIPSGGGF
AEYVKVPGHIVQHGGLIPIPEDISDEQASFVEPTNCCLKAVKKAGIAPGQTVLITGAGPI
GLMFIMLVNLFGARAIATDLLPSRIAKAKEVGAAAAFDARDADLNAKIQALTQGLGVDVS
LLAVPSESAFFQALECTRKGGKILFFAEFPDEVEIPLNPNVLYRREIDLLGSYSSSYRLQ
SLASDIIFNRRIDVDALISDRYPLAKLAEAVEQAVSPTADTYKILIYPDA
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcacaggtgttccgaggggtgaaccagcttagctacgaggagttacccattccg
gaaattgcagcggatgaggtgctggtacgggttaaggtggtggggttgtgccagtcggac
attaaaaagatccgctaccctctctacgagccaccgcgcatttttgggcacgaaacagcc
ggggaaattgctgccgtggggacagcggtaaagggctggcaggtgggccagcgggttgtg
gtgatgcaccacatcccctgtatgcactgtacctactgcctgaatgaaaactattcgatg
tgccatgtctataaaacgattacaacaaccgcagggtttattcccagcggcggtgggttt
gctgaatacgtgaaggttcccggtcacattgtgcagcacggtgggctgattccaattcct
gaggacatcagcgatgagcaagctagttttgtggagccgacgaactgctgcctgaaggcg
gtcaagaaggcggggattgcccccggtcaaacggtgctgattaccggcgccggaccaatt
ggtctgatgtttattatgctggtgaatctgtttggggcacgggcgatcgccaccgattta
ctcccctcccgcattgctaaagccaaagaagtgggtgctgctgctgcctttgatgcccgg
gatgcggatctcaatgccaagattcaagcgctcacccaaggattaggggtggatgtcagt
ttgttggccgttccgagcgagagcgccttttttcaagccctggagtgcacccgcaagggg
ggcaaaattctcttctttgctgaatttcccgatgaagtggagattcccctcaatcccaat
gttctttatcgccgggaaatcgatctcctcggcagctatagttcctcctatcgccttcag
tccttggccagtgacattatttttaatcgtcgtattgatgtggatgccctcatcagcgat
cgctatcccttggcaaagctggctgaggccgtcgagcaggccgtctcccccaccgccgac
acctacaagattctcatctatccggatgcctaa

DBGET integrated database retrieval system